Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVDWM2T)

• DOT Name: Type III endosome membrane protein TEMP (C1ORF210)
• Synonyms: TEMP
• Gene Name: C1ORF210
• UniProt ID: CA210_HUMAN
• Sequence:
  MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRY
  HASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL
• Function: May be involved in membrane trafficking between endosomes and plasma membrane.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Type III endosome membrane protein TEMP (C1ORF210).	[1]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Type III endosome membrane protein TEMP (C1ORF210).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Type III endosome membrane protein TEMP (C1ORF210).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Type III endosome membrane protein TEMP (C1ORF210).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Type III endosome membrane protein TEMP (C1ORF210).	[4]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.