Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVEHDZ1)

DOT Name	Aquaporin-12A (AQP12A)
Synonyms	AQP-12
Gene Name	AQP12A
Related Disease	Fatty liver disease ( ) Gastric cancer ( ) Stomach cancer ( )
UniProt ID	AQ12A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00230
Sequence	MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLL LTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEQSLPGTLLKLAAQGLGMQAACTLMRLC WAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAYSGPAV ALLVTVTAYTAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPLTGMVLAVLLHQG RLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVEGPHSS
Function	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Tissue Specificity	Restricted to the pancreas.
Reactome Pathway	Passive transport by Aquaporins (R-HSA-432047 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Fatty liver disease	DIS485QZ	Strong	Biomarker	[1]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[2]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Aquaporin-12A (AQP12A).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Aquaporin-12A (AQP12A).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Aquaporin-12A (AQP12A).	[4]
------------------------------------------------------------------------------------

References

1	Role of aquaporin-7 in ghrelin- and GLP-1-induced improvement of pancreatic -cell function after sleeve gastrectomy in obese rats.Int J Obes (Lond). 2017 Sep;41(9):1394-1402. doi: 10.1038/ijo.2017.135. Epub 2017 Jun 6.
2	Expression profile of multiple aquaporins in human gastric carcinoma and its clinical significance.Biomed Pharmacother. 2010 May;64(5):313-8. doi: 10.1016/j.biopha.2009.12.003. Epub 2010 Jan 8.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.