Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVVZRKY)

• DOT Name: B box and SPRY domain-containing protein (BSPRY)
• Gene Name: BSPRY
• UniProt ID: BSPRY_HUMAN
• Pfam ID: PF13765 ; PF00622
• Sequence:
  MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAE
  ERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSL
  CESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKE
  QEIFERTEEAEGILDPQESEMLNFNEKCTRSPLLTQLWATAVLGSLSGTEDIRIDERTVS
  PFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAYKV
  GVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDL
  QVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR
• Function: May regulate epithelial calcium transport by inhibiting TRPV5 activity.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of B box and SPRY domain-containing protein (BSPRY).	[1]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of B box and SPRY domain-containing protein (BSPRY).	[2]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of B box and SPRY domain-containing protein (BSPRY).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of B box and SPRY domain-containing protein (BSPRY).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of B box and SPRY domain-containing protein (BSPRY).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of B box and SPRY domain-containing protein (BSPRY).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of B box and SPRY domain-containing protein (BSPRY).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of B box and SPRY domain-containing protein (BSPRY).	[4]

References

• [1] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [2] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.