Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWJG0SO)

• DOT Name: Neuritin (NRN1)
• Gene Name: NRN1
• UniProt ID: NRN1_HUMAN
• Pfam ID: PF15056
• Sequence:
  MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKT
  NIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGS
  LLPAFPVLLVSLSAALATWLSF
• Function: Promotes neurite outgrowth and especially branching of neuritic processes in primary hippocampal and cortical cells.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Neuritin (NRN1) increases the response to substance of Arsenic.	[7]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Neuritin (NRN1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Neuritin (NRN1).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Neuritin (NRN1).	[3]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Neuritin (NRN1).	[4]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Neuritin (NRN1).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Neuritin (NRN1).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Neuritin (NRN1).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Neuritin (NRN1).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [4] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [5] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility. Toxicol Appl Pharmacol. 2008 Jan 15;226(2):199-205. doi: 10.1016/j.taap.2007.09.004. Epub 2007 Sep 15.