Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWWGQW0)

• DOT Name: Olfactory receptor 8J1 (OR8J1)
• Synonyms: Olfactory receptor OR11-183
• Gene Name: OR8J1
• Related Disease: Alzheimer disease
• UniProt ID: OR8J1_HUMAN
• Pfam ID: PF13853
• Sequence:
  MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYGLTMAGNLGIITLTSVDSRLQTPMY
  FFLQHLALINLGNSTVIAPKMLINFLVKKKTTSFYECATQLGGFLFFIVSEVIMLALMAY
  DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSSYVFSVSYCSSNIINHFYCD
  NVPLLALSCSDTYLPETVVFISAATNVVGSLIIVLVSYFNIVLSILKICSSEGRKKAFST
  CASHMMAVTIFYGTLLFMYVQPRSNHSLDTDDKMASVFYTLVIPMLNPLIYSLRNKDVKT
  ALQRFMTNLCYSFKTM
• Function: Odorant receptor.
• KEGG Pathway: Olfactory transduction (hsa04740)
• Reactome Pathway: Expression and translocation of olfactory receptors (R-HSA-9752946)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Altered Expression	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Olfactory receptor 8J1 (OR8J1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Olfactory receptor 8J1 (OR8J1).	[3]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Olfactory receptor 8J1 (OR8J1).	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Olfactory receptor 8J1 (OR8J1).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Olfactory receptor 8J1 (OR8J1).	[5]

References

• [1] Identification of Alzheimer's Disease Autoantibodies and Their Target Biomarkers by Phage Microarrays.J Proteome Res. 2019 Jul 5;18(7):2940-2953. doi: 10.1021/acs.jproteome.9b00258. Epub 2019 Jun 7.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.