Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWX4XK1)

• DOT Name: Small nuclear ribonucleoprotein G (SNRPG)
• Synonyms: snRNP-G; Sm protein G; Sm-G; SmG
• Gene Name: SNRPG
• Related Disease:
  Advanced cancer
  Alzheimer disease
  Alzheimer disease 3
  Lung adenocarcinoma
  Neoplasm
• UniProt ID: RUXG_HUMAN
• PDB ID: 3CW1 ; 3JCR ; 3PGW ; 4F7U ; 4PJO ; 4V98 ; 4WZJ ; 5MQF ; 5O9Z ; 5XJC ; 5XJL ; 5XJQ ; 5XJR ; 5XJT ; 5XJU ; 5YZG ; 5Z56 ; 5Z57 ; 5Z58 ; 6AH0 ; 6AHD ; 6FF7 ; 6ICZ ; 6ID0 ; 6ID1 ; 6QDV ; 6QW6 ; 6QX9 ; 6V4X ; 6Y53 ; 6Y5Q ; 7A5P ; 7ABG ; 7ABI ; 7B0Y ; 7DVQ ; 7EVO ; 7QTT ; 7VPX ; 7W59 ; 7W5A ; 7W5B ; 8C6J ; 8CH6 ; 8HK1
• Pfam ID: PF01423
• Sequence:
  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
  VIRGNSIIMLEALERV
• Function: Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing.
• KEGG Pathway: Spliceosome (hsa03040)
• Reactome Pathway:
  snRNP Assembly (R-HSA-191859)
  mRNA Splicing - Major Pathway (R-HSA-72163)
  mRNA Splicing - Minor Pathway (R-HSA-72165)
  RNA Polymerase II Transcription Termination (R-HSA-73856)
  SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs (R-HSA-77588)
  SARS-CoV-2 modulates host translation machinery (R-HSA-9754678)
  SLBP independent Processing of Histone Pre-mRNAs (R-HSA-111367)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Alzheimer disease 3	DISVT69G	Strong	Biomarker	[2]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[8]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[9]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[13]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[14]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Small nuclear ribonucleoprotein G (SNRPG).	[15]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Small nuclear ribonucleoprotein G (SNRPG).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Small nuclear ribonucleoprotein G (SNRPG).	[12]

References

• [1] The oncogenic potential of small nuclear ribonucleoprotein polypeptide G: a comprehensive and perspective view.Am J Transl Res. 2019 Nov 15;11(11):6702-6716. eCollection 2019.
• [2] Functional segregation of executive control network and frontoparietal network in Alzheimer's disease.Cortex. 2019 Nov;120:36-48. doi: 10.1016/j.cortex.2019.04.026. Epub 2019 May 18.
• [3] c-Myc targeted regulators of cell metabolism in a transgenic mouse model of papillary lung adenocarcinoma.Oncotarget. 2016 Oct 4;7(40):65514-65539. doi: 10.18632/oncotarget.11804.
• [4] Vaccination efficacy with marrow mesenchymal stem cell against cancer was enhanced under simulated microgravity.Biochem Biophys Res Commun. 2017 Apr 8;485(3):606-613. doi: 10.1016/j.bbrc.2017.01.136. Epub 2017 Feb 24.
• [5] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [14] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [15] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.