General Information of Drug Off-Target (DOT) (ID: OTX24CQI)

DOT Name Transcription elongation factor A protein-like 4 (TCEAL4)
Synonyms TCEA-like protein 4; Transcription elongation factor S-II protein-like 4
Gene Name TCEAL4
Related Disease
Differentiated thyroid carcinoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid gland undifferentiated (anaplastic) carcinoma ( )
UniProt ID
TCAL4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04538
Sequence
MEKLYSENEGMASNQGKMENEEQPQDERKPEVTCTLEDKKLENEGKTENKGKTGDEEMLK
DKGKPESEGEAKEGKSEREGESEMEGGSEREGKPEIEGKPESEGEPGSETRAAGKRPAED
DVPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMIREFDNMAKVQDEKRKSKQKLGAFL
WMQRNLQDPFYPRGPREFRGGCRAPRRDIEDIPYV
Function May be involved in transcriptional regulation.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Differentiated thyroid carcinoma DIS1V20Y Strong Altered Expression [1]
Thyroid cancer DIS3VLDH Strong Altered Expression [1]
Thyroid gland carcinoma DISMNGZ0 Strong Altered Expression [1]
Thyroid gland undifferentiated (anaplastic) carcinoma DISYBB1W Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Transcription elongation factor A protein-like 4 (TCEAL4). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transcription elongation factor A protein-like 4 (TCEAL4). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Transcription elongation factor A protein-like 4 (TCEAL4). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Transcription elongation factor A protein-like 4 (TCEAL4). [5]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Transcription elongation factor A protein-like 4 (TCEAL4). [6]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Transcription elongation factor A protein-like 4 (TCEAL4). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Transcription elongation factor A protein-like 4 (TCEAL4). [8]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Transcription elongation factor A protein-like 4 (TCEAL4). [9]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Transcription elongation factor A protein-like 4 (TCEAL4). [9]
------------------------------------------------------------------------------------

References

1 Down-regulation of transcription elogation factor A (SII) like 4 (TCEAL4) in anaplastic thyroid cancer.BMC Cancer. 2006 Nov 1;6:260. doi: 10.1186/1471-2407-6-260.
2 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.