Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXBFHK8)

• DOT Name: Mammaglobin-A (SCGB2A2)
• Synonyms: Mammaglobin-1; Secretoglobin family 2A member 2
• Gene Name: SCGB2A2
• UniProt ID: SG2A2_HUMAN
• Pfam ID: PF01099
• Sequence:
  MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID
  ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
• Tissue Specificity: Mammary gland specific. Over-expressed in breast cancer.

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Mammaglobin-A (SCGB2A2).	[1]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Mammaglobin-A (SCGB2A2).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Mammaglobin-A (SCGB2A2).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Mammaglobin-A (SCGB2A2).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Mammaglobin-A (SCGB2A2).	[5]

References

• [1] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [2] Gene expression profiling of human peri-implantation endometria between natural and stimulated cycles. Fertil Steril. 2008 Dec;90(6):2152-64.
• [3] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.