Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXYSIIV)

• DOT Name: Tyrosine-protein phosphatase non-receptor type 7 (PTPN7)
• Synonyms: EC 3.1.3.48; Hematopoietic protein-tyrosine phosphatase; HEPTP; Protein-tyrosine phosphatase LC-PTP
• Gene Name: PTPN7
• UniProt ID: PTN7_HUMAN
• PDB ID: 1ZC0; 2A3K; 2GP0; 2GPH; 2HVL; 2QDC; 2QDM; 2QDP; 3D42; 3D44; 3O4S; 3O4T; 3O4U
• EC Number: 3.1.3.48
• Pfam ID: PF00102
• Sequence:
  MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
  ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
  SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
  EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
  QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
  FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
• Function: Protein phosphatase that acts preferentially on tyrosine-phosphorylated MAPK1. Plays a role in the regulation of T and B-lymphocyte development and signal transduction.
• Tissue Specificity: Expressed exclusively in thymus and spleen.
• KEGG Pathway: MAPK sig.ling pathway (hsa04010)
• Reactome Pathway:
  Interleukin-37 signaling (R-HSA-9008059)
  Negative regulation of MAPK pathway (R-HSA-5675221)

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Tyrosine-protein phosphatase non-receptor type 7 (PTPN7).	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tyrosine-protein phosphatase non-receptor type 7 (PTPN7).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tyrosine-protein phosphatase non-receptor type 7 (PTPN7).	[3]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Tyrosine-protein phosphatase non-receptor type 7 (PTPN7).	[4]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Tyrosine-protein phosphatase non-receptor type 7 (PTPN7).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Tyrosine-protein phosphatase non-receptor type 7 (PTPN7).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Proteomic analysis of anti-cancer effects by paclitaxel treatment in cervical cancer cells. Gynecol Oncol. 2005 Jul;98(1):45-53. doi: 10.1016/j.ygyno.2005.04.010.
• [5] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [6] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.