Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYI33WH)

• DOT Name: ATPase SWSAP1 (SWSAP1)
• Synonyms: SWIM-type zinc finger 7-associated protein 1; SWS1-associated protein 1; ZSWIM7-associated protein 1; ZSWIM7AP1
• Gene Name: SWSAP1
• Related Disease: Ovarian cancer
• UniProt ID: SWAP1_HUMAN
• Sequence:
  MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMR
  LQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
  TAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGL
  RACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP
• Function: ATPase which is preferentially stimulated by single-stranded DNA and is involved in homologous recombination repair (HRR). Has a DNA-binding activity which is independent of its ATPase activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of ATPase SWSAP1 (SWSAP1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of ATPase SWSAP1 (SWSAP1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of ATPase SWSAP1 (SWSAP1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of ATPase SWSAP1 (SWSAP1).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of ATPase SWSAP1 (SWSAP1).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of ATPase SWSAP1 (SWSAP1).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of ATPase SWSAP1 (SWSAP1).	[7]

References

• [1] RAD-ical New Insights into RAD51 Regulation.Genes (Basel). 2018 Dec 13;9(12):629. doi: 10.3390/genes9120629.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.