Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYV3ARM)

• DOT Name: Dephospho-CoA kinase domain-containing protein (DCAKD)
• Gene Name: DCAKD
• UniProt ID: DCAKD_HUMAN
• Pfam ID: PF01121
• Sequence:
  MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVMARHVVQPGYPAHRRIVEVFGTEVLLE
  NGDINRKVLGDLIFNQPDRRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFET
  KKLLKYMKHTVVVYCDRDTQLARLMRRNSLNRKDAEARINAQLPLTDKARMARHVLDNSG
  EWSVTKRQVILLHTELERSLEYLPLRFGVLTGLAAIASLLYLLTHYLLPYA
• Reactome Pathway: Coenzyme A biosynthesis (R-HSA-196783)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Dephospho-CoA kinase domain-containing protein (DCAKD).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Dephospho-CoA kinase domain-containing protein (DCAKD).	[8]

References

• [1] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [9] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.