Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZEFR8N)

DOT Name Melanoma-associated antigen B4 (MAGEB4)
Synonyms MAGE-B4 antigen
Gene Name MAGEB4
Related Disease
Azoospermia ( )
Male infertility ( )
Oligospermia ( )
Tarsal-carpal coalition syndrome ( )
UniProt ID
MAGB4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01454 ; PF12440
Sequence
MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQ
EPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFL
LYKYKMKEPTTKAEMLKIISKKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVS
MLGPNDGNQSSAWTLPRNGLLMPLLSVIFLNGNCAREEEIWEFLNMLGIYDGKRHLIFGE
PRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTTPNNF
PLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM
Tissue Specificity Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Azoospermia DIS94181 Strong Genetic Variation [1]
Male infertility DISY3YZZ Strong Biomarker [1]
Oligospermia DIS6YJF3 Strong Genetic Variation [1]
Tarsal-carpal coalition syndrome DISY90L2 Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Melanoma-associated antigen B4 (MAGEB4). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Melanoma-associated antigen B4 (MAGEB4). [4]
------------------------------------------------------------------------------------

References

1 A no-stop mutation in MAGEB4 is a possible cause of rare X-linked azoospermia and oligozoospermia in a consanguineous Turkish family.J Assist Reprod Genet. 2017 May;34(5):683-694. doi: 10.1007/s10815-017-0900-z. Epub 2017 Apr 11.
2 Cancer-Testis Antigens as New Candidate Diagnostic Biomarkers for Transitional Cell Carcinoma of Bladder.Pathol Oncol Res. 2019 Jan;25(1):191-199. doi: 10.1007/s12253-017-0313-4. Epub 2017 Oct 20.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.