Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZKCSNP)

• DOT Name: F-box only protein 36 (FBXO36)
• Gene Name: FBXO36
• UniProt ID: FBX36_HUMAN
• Pfam ID: PF12937
• Sequence:
  MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHED
  FLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQT
  SHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKY
  GNLREKQP
• Function: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of F-box only protein 36 (FBXO36).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of F-box only protein 36 (FBXO36).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of F-box only protein 36 (FBXO36).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of F-box only protein 36 (FBXO36).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of F-box only protein 36 (FBXO36).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of F-box only protein 36 (FBXO36).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of F-box only protein 36 (FBXO36).	[7]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of F-box only protein 36 (FBXO36).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.