Details of the Drug

General Information of Drug (ID: DM1O3BY)

Drug Name

Mecasermin

Synonyms

Increlex (TN)

Indication

Disease Entry	ICD 11	Status	REF
Growth failure	LD2F.1Y	Approved	[1]
Laron syndrome	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

Therapeutic Class

Immunomodulatory Agents

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA

ADMET Property

Bioavailability: The bioavailability of drug is 100% [3]
Clearance: The clearance of drug is 0.04 L/h/kg []
Half-life: The concentration or amount of drug in body reduced by one-half in 5.8 hours []
Metabolism: The drug is metabolized via the liver and kidney [4]
Vd: The volume of distribution (Vd) of drug is 0.257 +/- 0.073 L/kg []

Cross-matching ID

Repurposed Drugs (RPD)

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Insulin-like growth factor I receptor (IGF1R)	TTHRID2	IGF1R_HUMAN	Inhibitor	[5]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Growth failure

ICD Disease Classification

LD2F.1Y

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Insulin-like growth factor I receptor (IGF1R)	DTT	IGF1R	1.64E-01	0.25	0.64

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Mecasermin (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Insulin-glulisine	DMQI0FU	Moderate	Increased risk of hypoglycemia by the combination of Mecasermin and Insulin-glulisine.	Acute diabete complication [5A2Y]	[6]
Insulin-aspart	DMX7V28	Moderate	Increased risk of hypoglycemia by the combination of Mecasermin and Insulin-aspart.	Acute diabete complication [5A2Y]	[7]
Insulin-detemir	DMOA4VW	Moderate	Increased risk of hypoglycemia by the combination of Mecasermin and Insulin-detemir.	Type-1/2 diabete [5A10-5A11]	[6]
Insulin degludec	DMPL395	Moderate	Increased risk of hypoglycemia by the combination of Mecasermin and Insulin degludec.	Type-1/2 diabete [5A10-5A11]	[6]
-----------

References

1	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2	Cardiac examination in children with Laron syndrome undergoing mecasermin therapy. J Pediatr Endocrinol Metab. 2018 Jun 27;31(6):675-679.
3	Griffith RS: The pharmacology of cephalexin. Postgrad Med J. 1983;59 Suppl 5:16-27.
4	Kabasakalian P, Taggart M, Townley E: Urinary excretion of pheniramine and its N-demthylated metabolites in man--comparison with chlorpheniramine and brompheniramine data. J Pharm Sci. 1968 Apr;57(4):621-3. doi: 10.1002/jps.2600570416.
5	IGF-1R, IGF-1 and IGF-2 expression as potential prognostic and predictive markers in colorectal-cancer. Virchows Arch. 2003 Aug;443(2):139-45.
6	Abad S, Moachon L, Blanche P, Bavoux F, Sicard D, Salmon-Ceron D "Possible interaction between glicazide, fluconazole and sulfamethoxazole resulting in severe hypoglycaemia." Br J Clin Pharmacol 52 (2001): 456-7. [PMID: 11678792]
7	Asplund K, Wiholm BE, Lithner F "Glibenclamide-associated hypoglycaemia: a report on 57 cases." Diabetologia 24 (1983): 412-7. [PMID: 6411511]