Details of the Drug

General Information of Drug (ID: DM1O3BY)

Drug Name
Mecasermin
Synonyms Increlex (TN)
Indication
Disease Entry ICD 11 Status REF
Growth failure LD2F.1Y Approved [1], [2]
Therapeutic Class
Immunomodulatory Agents
Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA
ADMET Property
Bioavailability
The bioavailability of drug is 100% [3]
Clearance
The clearance of drug is 0.04 L/h/kg [4]
Half-life
The concentration or amount of drug in body reduced by one-half in 5.8 hours [5]
Metabolism
The drug is metabolized via the liver and kidney [6]
Vd
The volume of distribution (Vd) of drug is 0.257 +/- 0.073 L/kg [4]
Cross-matching ID
DrugBank ID
DB01277
TTD ID
D0F3JT

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Insulin-like growth factor I receptor (IGF1R) TTHRID2 IGF1R_HUMAN Inhibitor [7], [8], [9], [10]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Growth failure
ICD Disease Classification LD2F.1Y
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Insulin-like growth factor I receptor (IGF1R) DTT IGF1R 1.64E-01 0.25 0.64
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Mecasermin (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Insulin-glulisine DMQI0FU Moderate Increased risk of hypoglycemia by the combination of Mecasermin and Insulin-glulisine. Acute diabete complication [5A2Y] [20]
Insulin-aspart DMX7V28 Moderate Increased risk of hypoglycemia by the combination of Mecasermin and Insulin-aspart. Acute diabete complication [5A2Y] [21]
Insulin-detemir DMOA4VW Moderate Increased risk of hypoglycemia by the combination of Mecasermin and Insulin-detemir. Type-1/2 diabete [5A10-5A11] [20]
Insulin degludec DMPL395 Moderate Increased risk of hypoglycemia by the combination of Mecasermin and Insulin degludec. Type-1/2 diabete [5A10-5A11] [20]

References

1 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2 2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).
3 Griffith RS: The pharmacology of cephalexin. Postgrad Med J. 1983;59 Suppl 5:16-27.
4 An FDA phase I clinical trial of quinacrine sterilization (QS). Int J Gynaecol Obstet. 2003 Oct;83 Suppl 2:S45-9.
5 FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41.
6 Kabasakalian P, Taggart M, Townley E: Urinary excretion of pheniramine and its N-demthylated metabolites in man--comparison with chlorpheniramine and brompheniramine data. J Pharm Sci. 1968 Apr;57(4):621-3. doi: 10.1002/jps.2600570416.
7 IGF-1R, IGF-1 and IGF-2 expression as potential prognostic and predictive markers in colorectal-cancer. Virchows Arch. 2003 Aug;443(2):139-45.
8 One of two chondrocyte-expressed isoforms of cartilage intermediate-layer protein functions as an insulin-like growth factor 1 antagonist. Arthritis Rheum. 2003 May;48(5):1302-14.
9 Analysis of the human type I insulin-like growth factor receptor promoter region. Biochem Biophys Res Commun. 1991 Jun 28;177(3):1113-20.
10 Insulin-like growth factor I receptor gene structure. J Biol Chem. 1992 May 25;267(15):10759-63.
11 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
12 Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family... Bioorg Med Chem Lett. 2010 Apr 15;20(8):2452-5.
13 Mecasermin rinfabate: insulin-like growth factor-I/insulin-like growth factor binding protein-3, mecaserimin rinfibate, rhIGF-I/rhIGFBP-3. Drugs R D. 2005;6(2):120-7.
14 MM-141, an IGF-IR- and ErbB3-directed bispecific antibody, overcomes network adaptations that limit activity of IGF-IR inhibitors. Mol Cancer Ther. 2014 Feb;13(2):410-25.
15 BiPar Sciences Co-founder Reunites Management Team At TriAct Therapeutics to Advance Clinical Stage Cancer Programs. TriAct Therapeutics. Sept. 10, 2009.
16 Clinical pipeline report, company report or official report of Amgen (2009).
17 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
18 Clinical Phase I study with an Insulin-like Growth Factor-1 receptor inhibitor: experiences in patients with squamous non-small cell lung carcinoma. Acta Oncol. 2011 Apr;50(3):441-7.
19 Clinical pipeline report, company report or official report of Roche (2009).
20 Abad S, Moachon L, Blanche P, Bavoux F, Sicard D, Salmon-Ceron D "Possible interaction between glicazide, fluconazole and sulfamethoxazole resulting in severe hypoglycaemia." Br J Clin Pharmacol 52 (2001): 456-7. [PMID: 11678792]
21 Asplund K, Wiholm BE, Lithner F "Glibenclamide-associated hypoglycaemia: a report on 57 cases." Diabetologia 24 (1983): 412-7. [PMID: 6411511]