Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTF3LTV)

DTP Name Ammonium transporter Rh type C (SLC42A3)
Gene Name SLC42A3
UniProt ID
Q9UBD6 (RHCG_HUMAN)
VARIDT ID
DTD0359
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms C15orf6; CDRC2; PDRC2; RHCG; RHGK; Rh family type C glycoprotein; Rh glycoprotein kidney; Rh type C glycoprotein; Rhesus blood group family type C glycoprotein; SLC42A3; Tumor-related protein DRC2
DTP Family Ammonium Transporter Channel (AMT) Family ;
Sequence
MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRY
PSFQDVHVMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVV
GVENLINADFCVASVCVAFGAVLGKVSPIQLLIMTFFQVTLFAVNEFILLNLLKVKDAGG
SMTIHTFGAYFGLTVTRILYRRNLEQSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAIS
YHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMVHIQNATLAGGVAVGTAAEMM
LMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGIIGGIVGAVTAA
SASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPF
WGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
Function This transportr may regulate transepithelial ammonia secretion and mediates the transport of electroneutral and bidirectional ammonium.
Endogenous Substrate(s) NH4+
TCDB ID
1.A.11.4.1
Gene ID
51458
Reactome Pathway
Rhesus glycoproteins mediate ammonium transport (R-HSA-444411 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ammonia DMOEVK6 Coronary artery disease BA80 Approved [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.54E-02 6.56E-02 2.68E-01
Adrenocortical carcinoma 2D11.Z Kidney 8.36E-05 1.33E-01 4.17E-01
Alopecia ED70 Skin from scalp 4.89E-08 -8.09E-01 -1.30E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.83E-01 4.66E-02 2.47E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.69E-01 1.01E-01 1.09E+00
Aortic stenosis BB70 Calcified aortic valve 2.66E-01 1.37E-01 2.71E-01
Apnea 7A40 Hyperplastic tonsil 5.30E-02 1.78E+00 1.43E+00
Arthropathy FA00-FA5Z Peripheral blood 1.71E-01 5.36E-02 3.55E-01
Asthma CA23 Nasal and bronchial airway 1.90E-04 1.33E-01 2.13E-01
Atopic dermatitis EA80 Skin 1.44E-06 5.43E-01 2.20E+00
Autism 6A02 Whole blood 5.13E-01 -9.49E-02 -3.51E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.65E-02 -1.66E-01 -9.72E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.68E-01 6.93E-02 4.01E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.14E-01 1.66E-01 3.16E-01
Batten disease 5C56.1 Whole blood 2.07E-01 1.44E-01 1.50E+00
Behcet's disease 4A62 Peripheral blood 9.82E-01 8.70E-03 5.33E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.67E-01 4.47E-03 1.93E-02
Bladder cancer 2C94 Bladder tissue 2.27E-08 7.03E-01 2.41E+00
Breast cancer 2C60-2C6Z Breast tissue 2.94E-05 2.47E-03 9.20E-03
Cardioembolic stroke 8B11.20 Whole blood 8.30E-02 5.72E-02 3.83E-01
Cervical cancer 2C77 Cervical tissue 1.37E-05 -1.70E+00 -1.29E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.52E-01 1.50E-02 4.60E-02
Chronic hepatitis C 1E51.1 Whole blood 6.37E-01 5.30E-03 3.44E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 4.87E-01 -1.75E-02 -9.84E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.79E-01 1.22E-01 3.81E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.56E-01 5.97E-02 2.91E-01
Colon cancer 2B90 Colon tissue 9.51E-04 1.22E-02 4.76E-02
Coronary artery disease BA80-BA8Z Peripheral blood 4.44E-01 -1.15E-01 -3.66E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.82E-01 -1.38E-01 -5.31E-01
Endometriosis GA10 Endometrium tissue 2.86E-01 -8.72E-02 -2.74E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.20E-01 1.50E-02 7.71E-02
Familial hypercholesterolemia 5C80.00 Whole blood 4.98E-02 -7.03E-02 -2.83E-01
Gastric cancer 2B72 Gastric tissue 1.21E-03 3.45E-01 4.38E+00
Glioblastopma 2A00.00 Nervous tissue 1.92E-50 -3.97E-01 -1.24E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.65E-01 -3.16E-01 -1.87E+00
Head and neck cancer 2D42 Head and neck tissue 7.80E-01 -2.15E+00 -5.40E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.40E-01 -4.90E-02 -3.00E-01
Huntington's disease 8A01.10 Whole blood 8.26E-01 7.26E-02 3.98E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.88E-01 -8.36E-02 -2.33E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.54E-01 5.86E-02 6.20E-01
Influenza 1.00E+30 Whole blood 7.98E-02 6.84E-01 2.32E+00
Interstitial cystitis GC00.3 Bladder tissue 1.68E-02 2.05E-01 1.49E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.07E-01 4.08E-02 1.65E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.25E-01 6.98E-03 2.22E-02
Ischemic stroke 8B11 Peripheral blood 1.77E-01 6.15E-02 3.45E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.30E-01 -2.63E-02 -8.10E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 9.17E-01 9.37E-03 2.15E-02
Lateral sclerosis 8B60.4 Skin 5.00E-01 -5.72E-02 -4.81E-01
Liver cancer 2C12.0 Liver tissue 4.04E-02 -2.12E-01 -7.23E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.63E-01 -2.42E-01 -6.86E-01
Lung cancer 2C25 Lung tissue 4.47E-35 1.19E-01 5.07E-01
Lupus erythematosus 4A40 Whole blood 2.96E-04 -1.88E-01 -4.66E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.75E-01 1.59E-02 5.99E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.80E-01 6.46E-02 2.86E-01
Melanoma 2C30 Skin 2.09E-01 -5.91E-01 -4.09E-01
Multiple myeloma 2A83.1 Bone marrow 7.49E-05 3.67E-01 2.50E+00
Multiple myeloma 2A83.1 Peripheral blood 2.46E-01 -9.25E-02 -3.19E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.28E-01 1.96E-01 9.30E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.61E-01 -6.06E-02 -2.72E-01
Myelofibrosis 2A20.2 Whole blood 1.44E-01 -6.43E-02 -5.06E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.39E-01 1.35E-01 4.32E-01
Myopathy 8C70.6 Muscle tissue 7.11E-02 -2.27E-01 -1.27E+00
Neonatal sepsis KA60 Whole blood 1.73E-04 -2.18E-01 -6.91E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.64E-01 7.00E-02 1.78E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.81E-01 -8.10E-02 -2.88E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.52E-01 1.46E-01 7.76E-01
Olive pollen allergy CA08.00 Peripheral blood 1.31E-01 2.04E-01 1.26E+00
Oral cancer 2B6E Oral tissue 8.55E-08 -2.36E+00 -1.38E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.54E-01 1.47E-02 4.60E-02
Osteoporosis FB83.1 Bone marrow 3.27E-02 4.49E-01 2.47E+00
Ovarian cancer 2C73 Ovarian tissue 7.14E-01 -6.40E-02 -2.27E-01
Pancreatic cancer 2C10 Pancreas 3.18E-02 -3.61E-01 -7.55E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.48E-01 -2.07E-01 -7.05E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.67E-02 -4.02E-02 -2.76E-01
Pituitary cancer 2D12 Pituitary tissue 1.10E-01 -1.69E-01 -6.65E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.33E-01 -8.58E-02 -3.40E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.38E-01 1.11E-01 4.13E-01
Polycythemia vera 2A20.4 Whole blood 1.11E-01 -5.99E-02 -4.86E-01
Pompe disease 5C51.3 Biceps muscle 2.08E-01 -6.55E-02 -4.47E-01
Preterm birth KA21.4Z Myometrium 1.25E-01 -1.99E-01 -7.76E-01
Prostate cancer 2C82 Prostate 1.29E-01 -1.41E-01 -2.26E-01
Psoriasis EA90 Skin 1.42E-48 3.37E+00 4.83E+00
Rectal cancer 2B92 Rectal colon tissue 4.40E-01 -2.23E-02 -1.07E-01
Renal cancer 2C90-2C91 Kidney 1.08E-03 -2.88E+00 -1.99E+00
Retinoblastoma 2D02.2 Uvea 8.83E-05 -7.91E-01 -1.81E+00
Rheumatoid arthritis FA20 Synovial tissue 8.49E-02 -2.05E-01 -5.07E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.92E-01 3.99E-02 8.64E-02
Schizophrenia 6A20 Prefrontal cortex 8.47E-01 -9.90E-03 -3.78E-02
Schizophrenia 6A20 Superior temporal cortex 8.71E-01 7.35E-03 5.91E-02
Scleroderma 4A42.Z Whole blood 4.89E-04 3.19E-01 2.03E+00
Seizure 8A60-8A6Z Whole blood 2.49E-01 -1.77E-01 -7.12E-01
Sensitive skin EK0Z Skin 9.28E-01 -1.27E-01 -3.30E-01
Sepsis with septic shock 1G41 Whole blood 9.22E-04 -1.11E-01 -3.44E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.39E-01 3.14E-02 1.37E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.24E-01 6.83E-02 2.78E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.84E-02 1.34E-01 1.87E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.01E-01 4.87E-01 3.27E-01
Skin cancer 2C30-2C3Z Skin 2.44E-04 -8.09E-01 -9.84E-01
Thrombocythemia 3B63 Whole blood 4.60E-01 -5.89E-02 -4.62E-01
Thrombocytopenia 3B64 Whole blood 9.71E-01 8.29E-02 4.19E-01
Thyroid cancer 2D10 Thyroid 2.50E-05 7.50E-02 2.64E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.42E-03 -3.42E-01 -8.70E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.44E-01 9.80E-02 5.68E-01
Type 2 diabetes 5A11 Liver tissue 3.14E-01 -1.03E-01 -1.01E+00
Ureter cancer 2C92 Urothelium 8.19E-02 -1.63E-01 -1.00E-01
Uterine cancer 2C78 Endometrium tissue 2.17E-01 2.55E-01 9.16E-02
Vitiligo ED63.0 Skin 8.49E-01 9.11E-02 1.38E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Ammonium transporter Rh type C (RHCG) DTT Info
DTP DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
[14C]methylamine DMRBZ3X Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

References

1 Characterization of ammonia transport by the kidney Rh glycoproteins RhBG and RhCG. Am J Physiol Renal Physiol. 2006 Feb;290(2):F297-305.
2 Functional analysis of human RhCG: comparison with E. coli ammonium transporter reveals similarities in the pore and differences in the vestibule. Am J Physiol Cell Physiol. 2009 Sep;297(3):C537-47.