Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT3YGCD)

DTT Name	Bacterial Protective antigen (Bact pagA)
Synonyms	pagA; PA of Bacillus anthracis; Bacterial toxins translocating protein; Bacterial anthracis protective antigen; Bact PA83; Bact PA-83
Gene Name	Bact pagA
DTT Type	Successful target	[1]
BioChemical Class	Bacillus anthracis protective antigen
UniProt ID	PAG_BACAN
TTD ID	T27999
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
Function	One of the three proteins composing the anthrax toxin, the agent which infects many mammalian species and that may cause death. PA binds to a receptor (ATR) in sensitive eukaryotic cells, thereby facilitating the translocation of the enzymatic toxin components, edema factor and lethal factor, across the target cell membrane. PA associated with LF causes death wheninjected, PA associated with EF produces edema. PA induces immunity to infection with anthrax.
KEGG Pathway	NOD-like receptor signaling pathway (bar04621 )
Reactome Pathway	Uptake and function of anthrax toxins (R-HSA-5210891 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Raxibacumab	DM7QG0M	Anthrax	1B97	Approved	[1]
------------------------------------------------------------------------------------

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AVP-21D9	DMMWEH6	Bacillus anthracis infection	1G40	Phase 1	[2]
IQ-DAA	DMHP71R	Bacillus anthracis infection	1G40	Phase 1	[3]
Valortim	DMYAIUB	Bacterial infection	1A00-1C4Z	Phase 1	[4]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anthrax vaccine	DM9GSWY	Bacillus anthracis infection	1G40	Discontinued in Phase 1	[5]
------------------------------------------------------------------------------------

References

1	Modulation of innate and adaptive immune responses by tofacitinib (CP-690,550). J Immunol. 2011 Apr 1;186(7):4234-43.
2	Efficacy and Safety of AVP-21D9, an Anthrax Monoclonal Antibody, in Animal Models and Humans. Antimicrob Agents Chemother. 2014 July; 58(7): 3618-3625.
3	Anti-toxin antibodies in prophylaxis and treatment of inhalation anthrax.Future Microbiol.2009 Feb;4(1):35-43.
4	Phase I Study Evaluating the Safety and Pharmacokinetics of MDX-1303, a Fully Human Monoclonal Antibody against Bacillus anthracis Protective Antigen, in Healthy Volunteers. Clin Vaccine Immunol. 2011 December; 18(12): 2136-2142.
5	Annual Reports in Medicinal Chemistry. Annette M. Doherty. 2005. Page(214).