Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5TPI6)

• DTT Name: Opioid receptor sigma 1 (OPRS1)
• Synonyms: hSigmaR1; Sigma1R; Sigma1-receptor; Sigma non-opioid intracellular receptor 1; Sigma 1-type opioid receptor; SRBP; SR31747-binding protein; SR31747 binding protein 1; SR-BP; SIG-1R; Opioid receptor, sigma 1, isoform 1; OPRS1 protein; Aging-associated gene 8 protein; AAG8
• Gene Name: SIGMAR1
• DTT Type: Successful target; [1]
• Related Disease: Cough [ICD-11: MD12]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: SGMR1_HUMAN
• TTD ID: T46360
• Sequence:
  MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
  LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
  WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
  TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
• Function: Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration. Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria. Plays a role in protecting cells against oxidative stress-induced cell death via its interaction with RNF112. Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane.
• Reactome Pathway: Potential therapeutics for SARS (R-HSA-9679191)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dextromethorphan	DMUDJZM	Cough	MD12	Approved	[1]
Dextromethorphan polistirex	DMEHCY5	Dry cough	MD12	Approved	[2]

9 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ADX N05	DMLBYRA	Mood disorder	6A60-6E23	Phase 3	[3]
AVP-786	DMV1SOR	Alzheimer disease	8A20	Phase 3	[4], [5]
CM-2395	DMASPWR	Schizophrenia	6A20	Phase 3	[6]
Igmesine	DMH97XA	Major depressive disorder	6A70.3	Phase 2	[7], [8], [9]
OPC-14523	DMB1WF3	Bulimia nervosa	6B81	Phase 2	[10]
ANAVEX 2-73	DM67OU4	Alzheimer disease	8A20	Phase 1	[11]
SA-5845	DM6XZRL	Central nervous system disease	8A04-8D87	Phase 1	[12], [4], [5]
SSR-125047	DMSUFW6	Schizophrenia	6A20	Phase 1	[13]
SSR-125329A	DMG6NI8	Immune System disease	4A01-4B41	Phase 1	[14], [4], [5]

27 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,2,4-triazole derivative 3	DMU9XMV	N. A.	N. A.	Patented	[15]
1,2,4-triazole derivative 4	DMHBJFN	N. A.	N. A.	Patented	[15]
Aryl alkanolamine derivative 1	DM417XY	N. A.	N. A.	Patented	[15]
Aryl alkanolamine derivative 2	DMUP0WH	N. A.	N. A.	Patented	[15]
Benzamide derivative 10	DM9PKU2	N. A.	N. A.	Patented	[16]
Benzamide derivative 11	DM4V3Y5	N. A.	N. A.	Patented	[16]
Benzamide derivative 7	DM7UEJT	N. A.	N. A.	Patented	[16]
Benzamide derivative 8	DMAIJHC	N. A.	N. A.	Patented	[16]
Benzamide derivative 9	DMVFSJZ	N. A.	N. A.	Patented	[16]
Isoindoline derivative 1	DMD19QC	N. A.	N. A.	Patented	[16]
Isoindoline derivative 2	DMTE0S3	N. A.	N. A.	Patented	[16]
Isoindoline derivative 3	DM2MYL9	N. A.	N. A.	Patented	[16]
Isoindoline derivative 4	DMP1NKI	N. A.	N. A.	Patented	[16]
Isoindoline derivative 5	DMIUTQW	N. A.	N. A.	Patented	[16]
Phenylpropylamine derivative 1	DMVCKZT	N. A.	N. A.	Patented	[15]
Phenylpropylamine derivative 2	DMTDIA6	N. A.	N. A.	Patented	[15]
Phenylpropylamine derivative 3	DMH3FUR	N. A.	N. A.	Patented	[15]
Phenylpropylamine derivative 4	DM0R653	N. A.	N. A.	Patented	[15]
Phenylpropylamine derivative 5	DMU0S2W	N. A.	N. A.	Patented	[15]
Piperazine derivative 7	DM9Y4ZV	N. A.	N. A.	Patented	[15]
Piperidine derivative 4	DM6C5DR	N. A.	N. A.	Patented	[15]
Piperidine derivative 5	DMQ0VK4	N. A.	N. A.	Patented	[15]
Piperidine derivative 6	DM0GCTY	N. A.	N. A.	Patented	[15]
PMID28051882-Compound-XIV	DM1RN89	N. A.	N. A.	Patented	[15]
PMID30185082-Compound-57	DMNDF1Z	N. A.	N. A.	Patented	[16]
PMID30185082-Compound-64	DMKD470	N. A.	N. A.	Patented	[16]
Pyrazole derivative 86	DMW3PJV	N. A.	N. A.	Patented	[15]

20 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BMS-181100	DM0HR5W	Psychotic disorder	6A20-6A25	Discontinued in Phase 3	[17], [18]
KB-5492	DM7IP8U	Peptic ulcer	DA61	Discontinued in Phase 2	[19], [4], [5]
OxycoDex	DMHFOIX	Pain	MG30-MG3Z	Discontinued in Phase 2	[4], [5]
Panamesine	DM6TPCJ	Psychotic disorder	6A20-6A25	Discontinued in Phase 2	[20], [4], [5]
DUP-734	DMI5EPB	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[21]
Gevotroline	DM520D8	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[22], [23]
AH-9700	DMXY5AV	Pollakiuria	MF50.1	Terminated	[25]
CNS-1307	DM03LZB	Schizophrenia	6A20	Terminated	[4], [5]
E-5842	DMV0QI1	Schizophrenia	6A20	Terminated	[13]
E-6276	DMTEY8W	Schizophrenia	6A20	Terminated	[13]
FH-510	DMJ35RC	Psychotic disorder	6A20-6A25	Terminated	[26], [4], [5]
HydrocoDex	DM4HA9C	Pain	MG30-MG3Z	Terminated	[4], [5]
LU-29252	DMDHLUC	Anxiety disorder	6B00-6B0Z	Terminated	[27], [4], [5]
MS-377	DMXERCA	Schizophrenia	6A20	Terminated	[13]
NE-033	DMEH50J	Psychotic disorder	6A20-6A25	Terminated	[28], [4], [5]
NE-100	DMP4J7T	Schizophrenia	6A20	Terminated	[13]
NPC-16377	DM35RTJ	Psychotic disorder	6A20-6A25	Terminated	[29], [4], [5]
PRE-084	DMDIYFH	Aging skin	EE40	Terminated	[30], [4], [5]
Rimcazole	DMKDS1C	Schizophrenia	6A20	Terminated	[13]
SR-31742A	DM7ZOLE	Schizophrenia	6A20	Terminated	[13]

3 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ANAVEX 1-41	DM1MQON	Alzheimer disease	8A20	Preclinical	[11]
ANAVEX 1007	DM2U16Z	Melanoma	2C30	Preclinical	[11]
Cutamesine	DMB1ET0	Major depressive disorder	6A70.3	Preclinical	[24], [4], [5]

12 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+)-SK&F10047	DM1QPA4	Discovery agent	N.A.	Investigative	[31]
(RS)-PPCC	DMA8DEG	Discovery agent	N.A.	Investigative	[32]
1,3-ditolylguanidine	DM04KS1	Discovery agent	N.A.	Investigative	[33], [34]
2-(1H-indol-3-yl)-N,N-dimethylethanamine	DMR9Q4Y	Discovery agent	N.A.	Investigative	[35]
BD-1047	DMFIDA0	Discovery agent	N.A.	Investigative	[36]
C-10068	DMNV1ST	Brain injury	NA07.Z	Investigative	[4], [5]
CM-156	DM7TX3D	Drug abuse	6C4G.1Z	Investigative	[4], [5]
CNS-1169	DMTEGNB	Schizophrenia	6A20	Investigative	[4], [5]
Dimemorfan	DM2Q3CL	Discovery agent	N.A.	Investigative	[37]
MC-113	DMPTNUQ	Central nervous system disease	8A04-8D87	Investigative	[4], [5]
MC-116	DMQC9UB	Central nervous system disease	8A04-8D87	Investigative	[4], [5]
[3H]pentazocine	DMF4TWE	Discovery agent	N.A.	Investigative	[31]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Alzheimer's disease	8A00.0	Entorhinal cortex	2.77E-06	-0.12	-0.62
Major depressive disorder	6A20	Pre-frontal cortex	4.34E-01	0.03	0.26
Prostate cancer	2C82	Prostate	9.08E-03	0.31	0.6
Melanoma	2C82	Skin	7.53E-01	-3.56E-03	-0.01
Schizophrenia	6A20	Pre-frontal cortex	7.77E-01	-0.02	-0.07
Schizophrenia	6A20	Superior temporal cortex	1.88E-01	-0.01	-0.17
Breast cancer	2C82	Breast tissue	1.60E-20	0.27	0.63

References

• [1] Dextromethorphan/quinidine: AVP 923, dextromethorphan/cytochrome P450-2D6 inhibitor, quinidine/dextromethorphan. Drugs R D. 2005;6(3):174-7.
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [3] Clinical pipeline report, company report or official report of SK BioPhamaceuticals.
• [4] Antitussives and substance abuse. Subst Abuse Rehabil. 2013 Nov 6;4:75-82.
• [5] Dextromethorphan antagonizes the acute depletion of brain serotonin by p-chloroamphetamine and H75/12 in rats. Brain Res. 1992 Oct 30;594(2):323-6.
• [6] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127)
• [7] Antiamnesic and neuroprotective effects of donepezil against learning impairments induced in mice by exposure to carbon monoxide gas. J Pharmacol Exp Ther. 2006 Jun;317(3):1307-19.
• [8] Sigma-1 receptor ligands: potential in the treatment of neuropsychiatric disorders. CNS Drugs. 2004;18(5):269-84.
• [9] Strain differences in sigma(1) receptor-mediated behaviours are related to neurosteroid levels. Eur J Neurosci. 2002 May;15(9):1523-34.
• [10] Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88.
• [11] 2011 Pipeline of Anavex.
• [12] Tumor imaging with 2 sigma-receptor ligands, 18F-FE-SA5845 and 11C-SA4503: a feasibility study. J Nucl Med. 2004 Nov;45(11):1939-45.
• [13] The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
• [14] SSR125329A, a high affinity sigma receptor ligand with potent anti-inflammatory properties. Eur J Pharmacol. 2002 Dec 5;456(1-3):123-31.
• [15] Are sigma modulators an effective opportunity for cancer treatment A patent overview (1996-2016).Expert Opin Ther Pat. 2017 May;27(5):565-578.
• [16] The sigma-2 (-2) receptor: a review of recent patent applications: 2013-2018.Expert Opin Ther Pat. 2018 Sep;28(9):655-663.
• [17] BMY 14802, a sigma receptor ligand for the treatment of schizophrenia. Neuropsychopharmacology. 1994 Feb;10(1):37-40.
• [18] The effects of BMY-14802 against L-DOPA- and dopamine agonist-induced dyskinesia in the hemiparkinsonian rat
• [19] Sigma receptor-mediated effects of a new antiulcer agent, KB-5492, on experimental gastric mucosal lesions and gastric alkaline secretion in rats. J Pharmacol Exp Ther. 1994 May;269(2):799-805.
• [20] Efficacy and safety of the sigma receptor ligand EMD 57445 (panamesine) in patients with schizophrenia: an open clinical trial. Pharmacopsychiatry. 1999 Mar;32(2):68-72.
• [21] Piperidinyltetralin sigma ligands. J Med Chem. 1994 Feb 4;37(3):364-70.
• [22] Sigma receptor ligands alter concentrations of corticosterone in plasma in the rat. Neuropharmacology. 1991 Jan;30(1):79-87.
• [23] Neuroendocrinological and neurochemical effects of sigma ligands. Neuropharmacology. 1992 Feb;31(2):157-62.
• [24] Effect of SA4503, a novel sigma1 receptor agonist, against glutamate neurotoxicity in cultured rat retinal neurons. Eur J Pharmacol. 1998 Jan 19;342(1):105-11.
• [25] Pharmacological actions of AH-9700 on micturition reflex in anesthetized rats. Eur J Pharmacol. 2001 Jan 26;412(2):171-9.
• [26] FH-510, a potent and selective ligand for rat brain sigma recognition sites. Eur J Pharmacol. 1993 Jul 6;238(1):89-92.
• [27] Involvement of sigma receptors in the modulation of the glutamatergic/NMDA neurotransmission in the dopaminergic systems. Eur J Pharmacol. 1999 Mar 5;368(2-3):183-96.
• [28] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004064)
• [29] Effects of the selective sigma receptor ligand, 6-[6-(4-hydroxypiperidinyl)hexyloxy]-3-methylflavone (NPC 16377), on behavioral and toxic effects of cocaine. J Pharmacol Exp Ther. 1993 Aug;266(2):473-82.
• [30] Antidepressant-like effect of PRE-084, a selective sigma1 receptor agonist, in Albino Swiss and C57BL/6J mice. Pharmacol Rep. 2009 Nov-Dec;61(6):1179-83.
• [31] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2552).
• [32] Novel sigma receptor ligands: synthesis and biological profile. J Med Chem. 2007 Mar 8;50(5):951-61.
• [33] Sigma1 and sigma2 receptor binding affinity and selectivity of SA4503 and fluoroethyl SA4503. Synapse. 2006 May;59(6):350-8.
• [34] Synthesis and characterization of [125I]-N-(N-benzylpiperidin-4-yl)-4- iodobenzamide, a new sigma receptor radiopharmaceutical: high-affinity bindi... J Med Chem. 1994 Jun 10;37(12):1737-9.
• [35] Dose-response study of N,N-dimethyltryptamine in humans. I. Neuroendocrine, autonomic, and cardiovascular effects. Arch Gen Psychiatry. 1994 Feb;51(2):85-97.
• [36] Characterization of two novel sigma receptor ligands: antidystonic effects in rats suggest sigma receptor antagonism. Eur J Pharmacol. 1995 Jul 14;280(3):301-10.
• [37] Dimemorfan protects rats against ischemic stroke through activation of sigma-1 receptor-mediated mechanisms by decreasing glutamate accumulation. J Neurochem. 2008 Jan;104(2):558-72.