Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9V5JH)

• DTT Name: Phospholipase A2 (PLA2G1B)
• Synonyms: Secreted phospholipase A(2); Phosphatidylcholine 2-acylhydrolase 1B; PLA2G1B; Group IB phospholipase A2
• Gene Name: PLA2G1B
• DTT Type: Successful target; [1]
• Related Disease:
  Leishmaniasis [ICD-11: 1F54]
  Peroxisomal disease [ICD-11: 5C57]
  Rosacea [ICD-11: ED90]
  Synthesis disorder [ICD-11: 5C52-5C59]
• BioChemical Class: Carboxylic ester hydrolase
• UniProt ID: PA21B_HUMAN
• TTD ID: T31479
• EC Number: EC 3.1.1.4
• Sequence:
  MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
  DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
  DRNAAICFSKAPYNKAHKNLDTKKYCQS
• Function: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules.
• KEGG Pathway:
  Glycerophospholipid metabolism (hsa00564)
  Ether lipid metabolism (hsa00565)
  Arachidonic acid metabolism (hsa00590)
  Linoleic acid metabolism (hsa00591)
  alpha-Linolenic acid metabolism (hsa00592)
  Metabolic pathways (hsa01100)
  Ras signaling pathway (hsa04014)
  Vascular smooth muscle contraction (hsa04270)
  Pancreatic secretion (hsa04972)
  Fat digestion and absorption (hsa04975)
• Reactome Pathway:
  Acyl chain remodelling of PE (R-HSA-1482839)
  Acyl chain remodelling of PI (R-HSA-1482922)
  Acyl chain remodelling of PC (R-HSA-1482788)
• BioCyc Pathway: MetaCyc:HS10199-MON

Molecular Interaction Atlas (MIA) of This DTT

5 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Cholic acid	DM7OKQV	Peroxisomal disorder	5C57	Approved	[2]
Clobetasol	DMUXP52	Rosacea	ED90.0	Approved	[1]
Clocortolone	DM9ZMQH	Rosacea	ED90.0	Approved	[3]
Diflorasone	DMI9PRJ	Rosacea	ED90.0	Approved	[4]
Miltefosine	DMND304	Leishmaniasis	1F54	Approved	[5]

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AllerB	DM78DOT	Allergy	4A80-4A85	Phase 2b	[6]
MANOALIDE	DMB4A8I	Arthritis	FA20	Phase 2	[7], [8]
MRX-4	DMQZWYE	Allergic rhinitis	CA08.0	Phase 2	[9]
MRX-6	DMLVQKF	Contact dermatitis	EK0Z	Phase 2	[10]
URSOLIC ACID	DM4SOAW	Metabolic syndrome x	5C50-5D2Z	Phase 2	[11]
Rilapladib	DMB9861	Arteriosclerosis	BD40	Phase 1	[12]

8 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Darapladib	DMSWLA3	Arteriosclerosis	BD40	Discontinued in Phase 3	[13], [14]
BMY-30129	DMA4UCP	Pruritus	EC90	Discontinued in Phase 2	[15], [16]
EPC-K1	DMZKBU9	Nerve injury	ND56.4	Discontinued in Phase 2	[17], [16]
SC-106	DMTZ7E4	Rheumatoid arthritis	FA20	Discontinued in Phase 2	[18]
WAY-123641	DMPE5XM	Asthma	CA23	Discontinued in Phase 2	[19]
PF-05212372	DMD83VY	Asthma	CA23	Discontinued in Phase 1	[20]
SB-435495	DM92BXN	Arteriosclerosis	BD40	Discontinued in Phase 1	[21]
YM-26734	DMEHAI2	Rheumatoid arthritis	FA20	Terminated	[22], [23]

28 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-Methyl-2,4-Pentanediol	DMD45CU	Discovery agent	N.A.	Investigative	[2]
3,9-dihydroxy-2,10-diprenylpterocap-6a-ene	DMXZ8RJ	Discovery agent	N.A.	Investigative	[24]
4'-hydroxy-6,3',5'-triprenylisoflavonone	DM7PWOL	Discovery agent	N.A.	Investigative	[24]
ABYSSINONE V	DMH3CK2	Discovery agent	N.A.	Investigative	[24]
Acetate Ion	DMD08RH	Discovery agent	N.A.	Investigative	[2]
AGN-190383	DM53R94	Discovery agent	N.A.	Investigative	[25]
Alpha-D-Mannose	DMF5DLW	Discovery agent	N.A.	Investigative	[2]
BM-162115	DMDNPML	Inflammation	1A00-CA43.1	Investigative	[26]
BOLINAQUINONE	DMVB6UG	Discovery agent	N.A.	Investigative	[27]
CACOSPONGIONOLIDE	DMIPJUS	Discovery agent	N.A.	Investigative	[28]
CACOSPONGIONOLIDE B	DMCSXNW	Discovery agent	N.A.	Investigative	[28]
Cacospongionolide E	DM2DYAV	Discovery agent	N.A.	Investigative	[28]
folipastatin	DMEPZ2I	Discovery agent	N.A.	Investigative	[29]
HELENAQUINONE	DM5MOLY	Discovery agent	N.A.	Investigative	[30]
Heptanoic Acid	DM4NY9H	Discovery agent	N.A.	Investigative	[31]
Hexane-1,6-Diol	DMWAPGI	Discovery agent	N.A.	Investigative	[2]
Hyrtiosulawesine	DMWLJ5S	Discovery agent	N.A.	Investigative	[32]
Lpc-Ether	DM1JGDM	Discovery agent	N.A.	Investigative	[2]
LY178002	DMI01YM	Discovery agent	N.A.	Investigative	[33]
LY256548	DM1KCHN	Discovery agent	N.A.	Investigative	[33]
Mepacrine	DMU8L7C	Discovery agent	N.A.	Investigative	[34]
methylglyoxal	DMRC3OZ	Discovery agent	N.A.	Investigative	[2]
N-Tridecanoic Acid	DMNZ37C	Discovery agent	N.A.	Investigative	[31]
P-Anisic Acid	DM8HWS9	Discovery agent	N.A.	Investigative	[2]
Petrosaspongiolide M	DMR8ZBT	Discovery agent	N.A.	Investigative	[35]
Petrosaspongiolide P	DMMVZFN	Discovery agent	N.A.	Investigative	[36]
SB-203347	DM3AWMF	Discovery agent	N.A.	Investigative	[37]
WA-8242-A1	DMNRBDP	Discovery agent	N.A.	Investigative	[38], [39]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Coronary artery disease	BA80-BA8Z	Peripheral blood	2.72E-01	-0.04	-0.17
Asthma	CA23	Nasal and bronchial airway	5.61E-01	1.50E-02	0.03
Rheumatoid arthritis	FA20	Synovial tissue	2.65E-01	-0.08	-0.21
Atopic dermatitis	EA90	Skin	1.05E-05	-0.11	-0.87
Sensitive skin	EA90	Skin	2.98E-01	0.07	0.52

References

• [1] Utilization of epidermal phospholipase A2 inhibition to monitor topical steroid action. Br J Dermatol. 1984 Jul;111 Suppl 27:195-203.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [3] Clocortolone pivalate: a paired comparison clinical trial of a new topical steroid in eczema/atopic dermatitis. Cutis. 1980 Jan;25(1):96-8.
• [4] Structures from powders: diflorasone diacetate. Steroids. 2009 Jan;74(1):102-11.
• [5] Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22.
• [6] Successful immunotherapy with T-cell epitope peptides of bee venom phospholipase A2 induces specific T-cell anergy in patients allergic to bee venom. J Allergy Clin Immunol. 1998 Jun;101(6 Pt 1):747-54.
• [7] Manoalide, a phospholipase A2 inhibitor, inhibits arachidonate incorporation and turnover in brain phospholipids of the awake rat. Neurochem Res. 1998 Oct;23(10):1251-7.
• [8] The effects of the phospholipase A2 inhibitor, manoalide, on cartilage degradation, stromelysin expression, and synovial fluid cell count induced b... Arthritis Rheum. 1996 Aug;39(8):1292-9.
• [9] Phospholipase A2, group IVA (cytosolic, calcium-dependent) (PLA2G4A). SciBX 1(41); doi:10.1038/scibx.2008.999. Nov. 13 2008
• [10] A novel treatment of contact dermatitis by topical application of phospholipase A2 inhibitor: a double-blind placebo-controlled pilot study. Int J Immunopathol Pharmacol. 2007 Jan-Mar;20(1):191-5.
• [11] Synthesis of benzoyl phenyl benzoates as effective inhibitors for phospholipase A2 and hyaluronidase enzymes. Bioorg Med Chem Lett. 2005 Sep 15;15(18):4100-4.
• [12] Effect of treatment for 12 weeks with rilapladib, a lipoprotein-associated phospholipase A2 inhibitor, on arterial inflammation as assessed with 18F-fluorodeoxyglucose-positron emission tomography imaging.J Am Coll Cardiol.2014 Jan 7-14;63(1):86-8.
• [13] Darapladib, a reversible lipoprotein-associated phospholipase A2 inhibitor, for the oral treatment of atherosclerosis and coronary artery disease. IDrugs. 2009 Oct;12(10):648-55.
• [14] Darapladib, a lipoprotein-associated phospholipase A2 inhibitor, in diabetic macular edema: a 3-month placebo-controlled study.Ophthalmology.2015 May;122(5):990-6.
• [15] Inhibitor of phospholipase A2 blocks eicosanoid and platelet activating factor biosynthesis and has topical anti-inflammatory activity. J Pharmacol Exp Ther. 1994 Nov;271(2):852-9.
• [16] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [17] Posttreatment with EPC-K1, an inhibitor of lipid peroxidation and of phospholipase A2 activity, reduces functional deficits after global ischemia in rats. Brain Res Bull. 1995;36(3):257-60.
• [18] US patent application no. 6,673,908, Tumor necrosis factor receptor 2.
• [19] Phosphodiesterase-IV inhibition, respiratory muscle relaxation and bronchodilation by WAY-PDA-641. J Pharmacol Exp Ther. 1994 Feb;268(2):888-96.
• [20] Phagedena due to leishmaniasis. Immunologic and experimental studies. Ann Dermatol Syphiligr (Paris). 1976;103(1):23-30.
• [21] The effect of lipoprotein-associated phospholipase A2 deficiency on pulmonary allergic responses in Aspergillus fumigatus sensitized mice. Respir Res. 2012 Nov 12;13:100.
• [22] Simplified YM-26734 Inhibitors of Secreted Phospholipase A2 Group IIA
• [23] Suppression of inflammatory responses to 12-O-tetradecanoyl-phorbol-13-acetate and carrageenin by YM-26734, a selective inhibitor of extracellular ... Br J Pharmacol. 1993 Sep;110(1):447-53.
• [24] Phospholipase A2 Inhibitors from an Erythrina Species from Samoa J. Nat. Prod. 60(6):537-539 (1997).
• [25] AGN 190383, a novel phospholipase inhibitor with topical anti-inflammatory activity. Agents Actions. 1991 Sep;34(1-2):70-2.
• [26] Investigation on the effect of experimental phospholipase A2 inhibitors on the formyl-methionyl-leucyl-phenylalanine-stimulated chemotaxis of human leukocytes in vitro. Arzneimittelforschung. 1998 Jan;48(1):77-81.
• [27] New sesquiterpene derivatives from the sponge Dysidea species with a selective inhibitor profile against human phospholipase A2 and other leukocyte... J Nat Prod. 2001 May;64(5):612-5.
• [28] A new cacospongionolide inhibitor of human secretory phospholipase A2 from the Tyrrhenian sponge Fasciospongia cavernosa and absolute configuration... J Nat Prod. 1998 Jul;61(7):931-5.
• [29] Folipastatin, a new depsidone compound from Aspergillus unguis as an inhibitor of phospholipase A2.Taxonomy, fermentation, isolation, structure determination and biological properties.J Antibiot (Tokyo).1992 Aug;45(8):1195-201.
• [30] New bioactive halenaquinone derivatives from South Pacific marine sponges of the genus Xestospongia. Bioorg Med Chem. 2010 Aug 15;18(16):6006-11.
• [31] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [32] Hyrtiazepine, an azepino-indole-type alkaloid from the Red Sea marine sponge Hyrtios erectus. J Nat Prod. 2006 Dec;69(12):1676-9.
• [33] The anti-inflammatory effects of LY178002 and LY256548. Agents Actions. 1989 Jun;27(3-4):300-2.
• [34] Involvement of protein kinase C activation in L-leucine-induced stimulation of protein synthesis in l6 myotubes. Cytotechnology. 2003 Nov;43(1-3):97-103.
• [35] Synthesis and pharmacological evaluation of a selected library of new potential anti-inflammatory agents bearing the gamma-hydroxybutenolide scaffo... J Med Chem. 2007 May 3;50(9):2176-84.
• [36] Petrosaspongiolides M-R: new potent and selective phospholipase A2 inhibitors from the New Caledonian marine sponge Petrosaspongia nigra. J Nat Prod. 1998 May;61(5):571-5.
• [37] SB 203347, an inhibitor of 14 kDa phospholipase A2, alters human neutrophil arachidonic acid release and metabolism and prolongs survival in murine... J Pharmacol Exp Ther. 1995 Sep;274(3):1254-62.
• [38] WA8242A1, A2 and B, novel secretary phospholipase A2 inhibitors produced by Streptomyces violaceusniger. III. Structure elucidation and total synth... J Antibiot (Tokyo). 1998 Jul;51(7):655-64.
• [39] WA8242A1, A2 and B, novel secretory phospholipase A2 inhibitors produced by Streptomyces violaceusniger. I. Taxonomy, production and purification. J Antibiot (Tokyo). 1998 Jan;51(1):1-7.