Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTAS2UO)

• DTT Name: Bacterial Urease (Bact ureC)
• Synonyms: Urease subunit alpha; Urea amidohydrolase subunit alpha
• Gene Name: Bact ureC
• DTT Type: Successful target; [1]
• BioChemical Class: Carbon-nitrogen hydrolase
• UniProt ID: URE1_KLEAE
• TTD ID: T28869
• Sequence:
  MSNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM
  LAADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIA
  AEGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRM
  LQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLKIHEDWGATPAAIDCALTVADEMD
  IQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNP
  TLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSD
  SQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHE
  VGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGAL
  GSARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQT
  YEVRVDGELITSEPADVLPMAQRYFLF
• Function: Catalyzes the hydrolysis of urea, leading to the production of carbon dioxide and ammonia. Allows many soil bacteria to use urea as a nitrogen source. An important virulence factor that improves survival of pathogenic bacteria under acidic conditions within the host and can also cause direct damage to the host tissue due to ammonia, CO2 or alkali production.

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetohydroxamic Acid	DMYX7NI	Urinary tract infection	GC08	Approved	[1]

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1-cyclohexyl-1-isopropyl-3,3-dimethylselenourea	DMS10LE	Discovery agent	N.A.	Investigative	[2]
3-(4-bromobenzyl)-1,1-dimethylselenourea	DMAKMIJ	Discovery agent	N.A.	Investigative	[2]
3-(4-bromophenyl)-1,1-dimethylthiourea	DMXMZRE	Discovery agent	N.A.	Investigative	[2]
3-dodecyl-1,1-dimethylthiourea	DMO5EBI	Discovery agent	N.A.	Investigative	[2]
N-glycylglycinehydroxamic acid	DMPEZHC	Discovery agent	N.A.	Investigative	[3]

References

• [1] Enzymatic, immunological and phylogenetic characterization of Brucella suis urease. BMC Microbiol. 2008 Jul 19;8:121.
• [2] Facile one-pot synthesis of thio and selenourea derivatives: a new class of potent urease inhibitors. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6387-91.
• [3] Design, synthesis, and evaluation of novel organophosphorus inhibitors of bacterial ureases. J Med Chem. 2008 Sep 25;51(18):5736-44.