General Information of Drug Therapeutic Target (DTT) (ID: TTECBXN)

DTT Name Oxysterols receptor LXR-alpha (NR1H3)
Synonyms Nuclear receptor subfamily 1 group H member 3; Nuclear receptor LXRalpha; Nuclear orphan receptor LXR-alpha; Liver X receptor alpha; LXRalpha; LXRA
Gene Name NR1H3
DTT Type
Patented-recorded target
[1]
BioChemical Class
Nuclear hormone receptor
UniProt ID
NR1H3_HUMAN
TTD ID
T52297
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Function
Interaction with retinoic acid receptor (RXR) shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. Plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism. Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity.
KEGG Pathway
PPAR signaling pathway (hsa03320 )
Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
Hepatitis C (hsa05160 )
Reactome Pathway
Nuclear Receptor transcription pathway (R-HSA-383280 )
SUMOylation of intracellular receptors (R-HSA-4090294 )
VLDLR internalisation and degradation (R-HSA-8866427 )
NR1H2 & NR1H3 regulate gene expression linked to lipogenesis (R-HSA-9029558 )
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux (R-HSA-9029569 )
NR1H2 & NR1H3 regulate gene expression to limit cholesterol uptake (R-HSA-9031525 )
NR1H2 & NR1H3 regulate gene expression linked to triglyceride lipolysis in adipose (R-HSA-9031528 )
NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis (R-HSA-9623433 )
NR1H2 & NR1H3 regulate gene expression linked to gluconeogenesis (R-HSA-9632974 )
PPARA activates gene expression (R-HSA-1989781 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
9 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
67S DMJL1MB N. A. N. A. Patented [2]
BDBM50177012 DM52IQF N. A. N. A. Patented [2]
BDBM50177019 DMEL28G N. A. N. A. Patented [2]
US9006244, E1 DMBF1C0 N. A. N. A. Patented [3]
US9006244, E2a DMPDF9B N. A. N. A. Patented [3]
US9006244, E2b DMP0TBO N. A. N. A. Patented [3]
US9073931, E1 DM2Z43I N. A. N. A. Patented [4]
US9073931, E2 DMK9FJG N. A. N. A. Patented [4]
US9073931, E3 DMCYM8P N. A. N. A. Patented [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Patented Agent(s)
32 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
12,17-dehydroxyriccardin C DMAUPQR Discovery agent N.A. Investigative [5]
12-dehydroxyriccardin C DMTOSXF Discovery agent N.A. Investigative [5]
17-dehydroxyriccardin C DM7UHJS Discovery agent N.A. Investigative [5]
2-(2-hexylphenyl)isoindoline-1,3-dione DMSI41E Discovery agent N.A. Investigative [5]
2-(2-phenethylphenyl)isoindoline-1,3-dione DM5NLQE Discovery agent N.A. Investigative [6]
2-Benzyl-3-phenyl-7-(trifluoromethyl)-2H-indazole DMANTCY Discovery agent N.A. Investigative [7]
2-benzyl-4,5,6,7-tetrachloroisoindoline-1,3-dione DMH76SO Discovery agent N.A. Investigative [8]
22R-hydroxycholesterol DME8273 Discovery agent N.A. Investigative [9]
24(S), 25-epoxycholesterol DMW2KI5 Discovery agent N.A. Investigative [10]
24(S)-hydroxycholesterol DMGMWA6 Discovery agent N.A. Investigative [11]
27-hydroxycholesterol DM2L6OZ Discovery agent N.A. Investigative [12]
4,12,17-dehydroxyriccardin C DM1XTJC Discovery agent N.A. Investigative [5]
4,17-dehydroxyriccardin C DMIZ0GO Discovery agent N.A. Investigative [5]
4-dehydroxyriccardin C DM93DQG Discovery agent N.A. Investigative [5]
5-chloro-2-(4-phenylbutyl)isoindoline-1,3-dione DM9QBAZ Discovery agent N.A. Investigative [8]
acetyl-podocarpic dimer DMGTPFY Discovery agent N.A. Investigative [13]
AZ12260493 DMQ5H2V Discovery agent N.A. Investigative [14]
desmosterol DMV8SUM Discovery agent N.A. Investigative [15]
GSK-9772 DM4WS3R Discovery agent N.A. Investigative [16]
GSK2033 DM9GPAU Discovery agent N.A. Investigative [17]
Guttiferone I DMBXGVH Discovery agent N.A. Investigative [18]
GW-3965 DMG60ET Major depressive disorder 6A70.3 Investigative [7]
L-783483 DM6OTGE Discovery agent N.A. Investigative [19]
N-{4-[2-(3-Hydroxyphenyl)ethyl]phenyl}phthalimide DMO3VLJ Discovery agent N.A. Investigative [6]
N-{4-[2-(3-Methoxyphenyl)ethyl]phenyl}phthalimide DMZ4N7Q Discovery agent N.A. Investigative [6]
N-{4-[2-(4-Hydroxyphenyl)ethyl]phenyl}phthalimide DMXU5IS Discovery agent N.A. Investigative [6]
N-{4-[2-(4-Methoxyphenyl)ethyl]phenyl}phthalimide DM0S71O Discovery agent N.A. Investigative [6]
paxilline DMPF2N1 Discovery agent N.A. Investigative [20]
Riccardin C DM6MYGX Discovery agent N.A. Investigative [5]
SR9238 DM2WIGO Discovery agent N.A. Investigative [1]
WAY-214950 DM8ODI7 Discovery agent N.A. Investigative [7]
WAY-254011 DMC83HA Discovery agent N.A. Investigative [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 32 Investigative Drug(s)

References

1 A liver-selective LXR inverse agonist that suppresses hepatic steatosis. ACS Chem Biol. 2013 Mar 15;8(3):559-67.
2 Piperazine derivatives as liver X receptor modulators. US10144715.
3 Liver X receptor modulators. US9006244.
4 Liver X receptor modulators. US9073931.
5 Co-existence of alpha-glucosidase-inhibitory and liver X receptor-regulatory activities and their separation by structural development. Bioorg Med Chem. 2008 Apr 15;16(8):4272-85.
6 Separation of alpha-glucosidase-inhibitory and liver X receptor-antagonistic activities of phenethylphenyl phthalimide analogs and generation of LX... Bioorg Med Chem. 2009 Jul 15;17(14):5001-14.
7 Indazole-based liver X receptor (LXR) modulators with maintained atherosclerotic lesion reduction activity but diminished stimulation of hepatic tr... J Med Chem. 2008 Nov 27;51(22):7161-8.
8 Liver X receptor antagonists with a phthalimide skeleton derived from thalidomide-related glucosidase inhibitors. Bioorg Med Chem Lett. 2007 Jul 15;17(14):3957-61.
9 An oxysterol signalling pathway mediated by the nuclear receptor LXR alpha. Nature. 1996 Oct 24;383(6602):728-31.
10 Brain endogenous liver X receptor ligands selectively promote midbrain neurogenesis. Nat Chem Biol. 2013 Feb;9(2):126-33.
11 Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway. J Biol Chem. 1997 Feb 7;272(6):3137-40.
12 27-hydroxycholesterol is an endogenous ligand for liver X receptor in cholesterol-loaded cells. J Biol Chem. 2001 Oct 19;276(42):38378-87.
13 A potent synthetic LXR agonist is more effective than cholesterol loading at inducing ABCA1 mRNA and stimulating cholesterol efflux. J Biol Chem. 2002 Mar 22;277(12):10021-7.
14 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 602).
15 Sterol intermediates from cholesterol biosynthetic pathway as liver X receptor ligands. J Biol Chem. 2006 Sep 22;281(38):27816-26.
16 Structure-guided design of N-phenyl tertiary amines as transrepression-selective liver X receptor modulators with anti-inflammatory activity. J Med Chem. 2008 Sep 25;51(18):5758-65.
17 Discovery of tertiary sulfonamides as potent liver X receptor antagonists. J Med Chem. 2010 Apr 22;53(8):3412-6.
18 Guttiferone I, a new prenylated benzophenone from Garcinia humilis as a liver X receptor ligand. J Nat Prod. 2005 Apr;68(4):617-9.
19 A novel liver X receptor agonist establishes species differences in the regulation of cholesterol 7alpha-hydroxylase (CYP7a). Endocrinology. 2002 Jul;143(7):2548-58.
20 A natural product ligand of the oxysterol receptor, liver X receptor. J Pharmacol Exp Ther. 2003 Oct;307(1):291-6.
21 Discovery and SAR of cinnolines/quinolines as liver X receptor (LXR) agonists with binding selectivity for LXRbeta. Bioorg Med Chem. 2009 May 15;17(10):3519-27.