Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIU7X1)

• DTT Name: Herpes simplex virus DNA polymerase UL30 (HSV UL30)
• Synonyms: HSV DNA polymerase catalytic subunit
• Gene Name: HSV UL30
• DTT Type: Successful target; [1]
• Related Disease:
  Cytomegaloviral disease [ICD-11: 1D82]
  Herpes simplex infection [ICD-11: 1F00]
  Human immunodeficiency virus disease [ICD-11: 1C60-1C62]
  Mature B-cell lymphoma [ICD-11: 2A85]
  Retinal inflammation [ICD-11: 9B72]
  Virus infection [ICD-11: 1A24-1D9Z]
• BioChemical Class: DNA polymerase type-B
• UniProt ID: DPOL_HHV11
• TTD ID: T37847
• Sequence:
  MFSGGGGPLSPGGKSAARAASGFFAPAGPRGASRGPPPCLRQNFYNPYLAPVGTQQKPTG
  PTQRHTYYSECDEFRFIAPRVLDEDAPPEKRAGVHDGHLKRAPKVYCGGDERDVLRVGSG
  GFWPRRSRLWGGVDHAPAGFNPTVTVFHVYDILENVEHAYGMRAAQFHARFMDAITPTGT
  VITLLGLTPEGHRVAVHVYGTRQYFYMNKEEVDRHLQCRAPRDLCERMAAALRESPGASF
  RGISADHFEAEVVERTDVYYYETRPALFYRVYVRSGRVLSYLCDNFCPAIKKYEGGVDAT
  TRFILDNPGFVTFGWYRLKPGRNNTLAQPAAPMAFGTSSDVEFNCTADNLAIEGGMSDLP
  AYKLMCFDIECKAGGEDELAFPVAGHPEDLVIQISCLLYDLSTTALEHVLLFSLGSCDLP
  ESHLNELAARGLPTPVVLEFDSEFEMLLAFMTLVKQYGPEFVTGYNIINFDWPFLLAKLT
  DIYKVPLDGYGRMNGRGVFRVWDIGQSHFQKRSKIKVNGMVNIDMYGIITDKIKLSSYKL
  NAVAEAVLKDKKKDLSYRDIPAYYAAGPAQRGVIGEYCIQDSLLVGQLFFKFLPHLELSA
  VARLAGINITRTIYDGQQIRVFTCLLRLADQKGFILPDTQGRFRGAGGEAPKRPAAARED
  EERPEEEGEDEDEREEGGGEREPEGARETAGRHVGYQGARVLDPTSGFHVNPVVVFDFAS
  LYPSIIQAHNLCFSTLSLRADAVAHLEAGKDYLEIEVGGRRLFFVKAHVRESLLSILLRD
  WLAMRKQIRSRIPQSSPEEAVLLDKQQAAIKVVCNSVYGFTGVQHGLLPCLHVAATVTTI
  GREMLLATREYVHARWAAFEQLLADFPEAADMRAPGPYSMRIIYGDTDSIFVLCRGLTAA
  GLTAVGDKMASHISRALFLPPIKLECEKTFTKLLLIAKKKYIGVIYGGKMLIKGVDLVRK
  NNCAFINRTSRALVDLLFYDDTVSGAAAALAERPAEEWLARPLPEGLQAFGAVLVDAHRR
  ITDPERDIQDFVLTAELSRHPRAYTNKRLAHLTVYYKLMARRAQVPSIKDRIPYVIVAQT
  REVEETVARLAALRELDAAAPGDEPAPPAALPSPAKRPRETPSPADPPGGASKPRKLLVS
  ELAEDPAYAIAHGVALNTDYYFSHLLGAACVTFKALFGNNAKITESLLKRFIPEVWHPPD
  DVAARLRTAGFGAVGAGATAEETRRMLHRAFDTLA
• Function: Replicates viral genomic DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein. Additionally, the polymerase contains an intrinsic ribonuclease H (RNase H) activity that specifically degrades RNA/DNA heteroduplexes or duplex DNA substrates in the 5' to 3' direction. Therefore, it can catalyze the excision of the RNA primers that initiate the synthesis of Okazaki fragments at a replication fork during viral DNA replication.

Molecular Interaction Atlas (MIA) of This DTT

10 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aciclovir	DMYLOVR	Virus infection	1A24-1D9Z	Approved	[2]
Cidofovir	DMA13GD	Cytomegalovirus infection	1D82	Approved	[2]
Cytarabine	DMZD5QR	Acute lymphoblastic leukaemia	2A85	Approved	[3]
Famciclovir	DMJHLSD	Virus infection	1A24-1D9Z	Approved	[4]
Foscavir	DM9KJLZ	Cytomegalovirus retinitis	9B72.00	Approved	[5]
Ganciclovir	DM1MBYQ	Virus infection	1A24-1D9Z	Approved	[6]
Penciclovir	DMOUMDV	Human immunodeficiency virus infection	1C62	Approved	[1]
Valaciclovir	DMHKS94	Virus infection	1A24-1D9Z	Approved	[7]
Valacyclovir Hydrochloride	DM5I1CE	Herpes simplex virus infection	1F00	Approved	[2]
Valganciclovir	DMS2IUH	Virus infection	1A24-1D9Z	Approved	[5]

8 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Netivudine	DMTKRY1	Virus infection	1A24-1D9Z	Phase 3	[8]
Fialuridine	DMCIGRB	Hepatitis B virus infection	1E51.0	Phase 2	[9]
URSOLIC ACID	DM4SOAW	Metabolic syndrome x	5C50-5D2Z	Phase 2	[10]
Valomaciclovir stearate	DMAEB9O	Varicella zoster virus infection	1E91	Phase 2	[11]
GS-9219	DMTJQ8S	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[12]
BETULINIC ACID	DMBUI2A	Melanoma	2C30	Phase 1	[13]
Guanosine	DM4T5LH	N. A.	N. A.	Phase 1	[14]
ROCICLOVIR	DMDRBNJ	Virus infection	1A24-1D9Z	Phase 1	[15], [16]

5 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Tomeglovir	DMY40KZ	Virus infection	1A24-1D9Z	Discontinued in Phase 2	[17]
Aphidicolin	DM71C6D	N. A.	N. A.	Discontinued in Phase 1	[18], [19]
Chpmpc	DMJ5UYL	Virus infection	1A24-1D9Z	Discontinued in Phase 1	[20]
Amitivir	DM64YJW	Virus infection	1A24-1D9Z	Terminated	[23]
GR-95168	DMAHNF6	Virus infection	1A24-1D9Z	Terminated	[24]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IDX136	DMRIMZL	Hepatitis C virus infection	1E51.1	Preclinical	[21], [22]

27 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+)-Myristinin A	DM7FZHI	Discovery agent	N.A.	Investigative	[25]
(+)-Myristinin D	DMEK07T	Discovery agent	N.A.	Investigative	[25]
(24E)-3beta-hydroxy-7,24-euphadien-26-oic acid	DM1RYH9	Discovery agent	N.A.	Investigative	[26]
2'-deoxythymidine triphosphate	DM9OEJT	Discovery agent	N.A.	Investigative	[27]
3-cis-p-coumaroyl maslinic acid	DM78FWG	Discovery agent	N.A.	Investigative	[13]
3-Oximo-olean-12-en-29-oic acid	DMVIRLX	Discovery agent	N.A.	Investigative	[28]
3-trans-p-coumaroyl maslinic acid	DMOQWDS	Discovery agent	N.A.	Investigative	[13]
3alpha-O-trans-p-coumaroyl-7-labden-15-oic acid	DM4M6LR	Discovery agent	N.A.	Investigative	[29]
3beta-hydroxyrus-12,19(29)-dien-28-oic acid	DML8NY0	Discovery agent	N.A.	Investigative	[10]
3beta-hydroxyrus-18,20(30)-dien-28-oic acid	DMKL59W	Discovery agent	N.A.	Investigative	[10]
5-propenyl-2'-deoxyuridine triphosphate	DM6A902	Discovery agent	N.A.	Investigative	[27]
5-propenyl-arabinofuranosyluracil 5'-triphosphate	DM762FY	Discovery agent	N.A.	Investigative	[27]
6-(3-Ethyl-phenylamino)-1H-pyrimidine-2,4-dione	DMKUHN9	Discovery agent	N.A.	Investigative	[30]
6-(4-Bromo-phenylamino)-1H-pyrimidine-2,4-dione	DMCYQDU	Discovery agent	N.A.	Investigative	[30]
6-(4-Chloro-phenylamino)-1H-pyrimidine-2,4-dione	DM5LUF4	Discovery agent	N.A.	Investigative	[30]
Alpha,beta-methylene-dATP	DMHRME4	Discovery agent	N.A.	Investigative	[31]
Alpha,beta-methylene-dCTP	DMJI8TX	Discovery agent	N.A.	Investigative	[31]
Alpha,beta-methylene-dGTP	DMPZS80	Discovery agent	N.A.	Investigative	[31]
Alpha,beta-methylene-dTTP	DMPAHJF	Discovery agent	N.A.	Investigative	[31]
DdCTP SODIUM	DMHLNA2	Discovery agent	N.A.	Investigative	[32]
Gallic acid 5,6-dihydroxy-3-carboxyphenylester	DMNWU83	Discovery agent	N.A.	Investigative	[33]
Guanosine-5'-Monophosphate	DM3SLZK	Discovery agent	N.A.	Investigative	[14]
Mahureone D	DM5WNH8	Discovery agent	N.A.	Investigative	[32]
OLEANOLIC_ACID	DMWDMJ3	Discovery agent	N.A.	Investigative	[10]
PENICILLIOL A	DMZUES2	Discovery agent	N.A.	Investigative	[34]
PMEA	DMBKVJY	Discovery agent	N.A.	Investigative	[35]
TALAROFLAVONE	DMW24JP	Discovery agent	N.A.	Investigative	[36]

References

• [1] Antimicrobial strategies: inhibition of viral polymerases by 3'-hydroxyl nucleosides. Drugs. 2009;69(2):151-66.
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [3] Chromatin-associated proteins HMGB1/2 and PDIA3 trigger cellular response to chemotherapy-induced DNA damage. Mol Cancer Ther. 2009 Apr;8(4):864-72.
• [4] Penciclovir cream--improved topical treatment for herpes simplex infections. Skin Pharmacol Physiol. 2004 Sep-Oct;17(5):214-8.
• [5] Drug targets in cytomegalovirus infection. Infect Disord Drug Targets. 2009 Apr;9(2):201-22.
• [6] Application of real time polymerase chain reaction to the diagnosis and treatment of cytomegalovirus infection after allogeneic hematopoietic stem cell transplantation. Zhonghua Xue Ye Xue Za Zhi. 2009 Feb;30(2):77-81.
• [7] Extensive oral shedding of human herpesvirus 8 in a renal allograft recipient. Oral Microbiol Immunol. 2009 Apr;24(2):109-15.
• [8] Current pharmacological approaches to the therapy of varicella zoster virus infections: a guide to treatment. Drugs. 1999 Feb;57(2):187-206.
• [9] Fialuridine and its metabolites inhibit DNA polymerase gamma at sites of multiple adjacent analog incorporation, decrease mtDNA abundance, and cause mitochondrial structural defects in cultured hepatoblasts. Proc Natl Acad Sci U S A. 1996 Apr 16;93(8):3592-7.
• [10] DNA polymerase beta inhibitors from Baeckea gunniana. J Nat Prod. 1999 Dec;62(12):1624-6.
• [11] Progress in the Development of New Therapies for Herpesvirus Infections. Curr Opin Virol. 2011 December 1; 1(6): 548-554.
• [12] GS-9219--a novel acyclic nucleotide analogue with potent antineoplastic activity in dogs with spontaneous non-Hodgkin's lymphoma. Clin Cancer Res. 2008 May 1;14(9):2824-32.
• [13] DNA polymerase beta inhibitors from Tetracera boiviniana. J Nat Prod. 1999 Dec;62(12):1660-3.
• [14] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [15] Herpes simplex virus type 1 DNA polymerase. Mechanism of inhibition by acyclovir triphosphate. J Biol Chem. 1989 May 5;264(13):7405-11.
• [16] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [17] Focus on new drugs in development against human cytomegalovirus. Drugs. 2002;62(13):1853-8.
• [18] Proteasome regulation of ULBP1 transcription. J Immunol. 2009 May 15;182(10):6600-9.
• [19] Characterization of an aphidicolin-resistant mutant of herpes simplex virus type 2 which induces an altered viral DNA polymerase. Virology. 1984 May;135(1):87-96.
• [20] Conversion of 1-[((S)-2-hydroxy-2-oxo-1,4,2-dioxaphosphorinan-5-yl)methyl]cytosine to cidofovir by an intracellular cyclic CMP phosphodiesterase.. Antimicrob Agents Chemother. 1997 March; 41(3): 641-646.
• [21] Therapy with amineptine, a dopamine reuptake inhibitor, in patients with major depression. Indian J Psychiatry. 1997 Apr;39(2):147-53.
• [22] Idenix Pharmaceuticals Advances HCV Discovery Program to Clinic. News for Idenix. 2008.
• [23] Approaches and strategies for the treatment of influenza virus infections. Antivir Chem Chemother. 1999 Jul;10(4):155-85.
• [24] US patent application no. 2004,0023,290, Novel therapeutic agents that modulate enzymatic processes.
• [25] (+)-Myristinins A and D from Knema elegans, which inhibit DNA polymerase beta and cleave DNA. J Nat Prod. 2005 Nov;68(11):1625-8.
• [26] A new 7,8-euphadien-type triterpenoid from Brackenridgea nitida and Bleasdalea bleasdalei that inhibits DNA polymerase beta. J Nat Prod. 2000 Oct;63(10):1356-60.
• [27] Inhibition of human hepatitis B virus DNA polymerase and duck hepatitis B virus DNA polymerase by triphosphates of thymidine analogs and pharmacokinetic properties of the corresponding nucleosides. JMed Virol. 1988 Dec;26(4):353-62.
• [28] DNA polymerase beta inhibitors from Sandoricum koetjape. J Nat Prod. 1999 Aug;62(8):1110-3.
• [29] Harbinatic acid, a novel and potent DNA polymerase beta inhibitor from Hardwickia binata. J Nat Prod. 1999 Jul;62(7):1000-2.
• [30] Inhibitors of Bacillus subtilis DNA polymerase III. 6-Anilinouracils and 6-(alkylamino)uracils. J Med Chem. 1980 Jan;23(1):34-8.
• [31] Alpha,beta-methylene-2'-deoxynucleoside 5'-triphosphates as noncleavable substrates for DNA polymerases: isolation, characterization, and stability... J Med Chem. 2008 Oct 23;51(20):6460-70.
• [32] Acylphloroglucinol derivatives from Mahurea palustris. J Nat Prod. 2005 Jul;68(7):979-84.
• [33] Differential inhibition of reverse transcriptase and various DNA polymerases by digallic acid and its derivatives. J Nat Prod. 1990 Sep-Oct;53(5):1234-40.
• [34] Penicilliols A and B, novel inhibitors specific to mammalian Y-family DNA polymerases. Bioorg Med Chem. 2009 Mar 1;17(5):1811-6.
• [35] Herpes simplex virus-specified DNA polymerase is the target for the antiviral action of 9-(2-phosphonylmethoxyethyl)adenine. J Biol Chem. 1991 Jan 5;266(1):238-44.
• [36] 1-deoxyrubralactone, a novel specific inhibitor of families X and Y of eukaryotic DNA polymerases from a fungal strain derived from sea algae. Bioorg Med Chem. 2008 Mar 15;16(6):2939-44.