Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMSFAW)

• DTT Name: Cannabinoid receptor 2 (CB2)
• Synonyms: hCB2; Cannabinoid CB2 receptor; CX5; CB2B; CB2A; CB-2
• Gene Name: CNR2
• DTT Type: Successful target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: CNR2_HUMAN
• TTD ID: T37693
• Sequence:
  MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
  SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
  VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
  ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
  VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
  LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
• Function: May function in inflammatory response, nociceptive transmission and bone homeostasis. Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Guanfacine extended release	DMB1CZ8	Attention deficit hyperactivity disorder	6A05.Z	Approved	[1]
NABILONE	DMVRYT2	Insomnia	7A00-7A0Z	Approved	[2]

10 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
842166X	DMOV0AP	Pain	MG30-MG3Z	Phase 2	[3]
APD371	DM3XT5V	Crohn disease	DD70	Phase 2	[4]
Beta-caryophyllene	DM7583A	Pain	MG30-MG3Z	Phase 2	[5]
GW-42004	DMY3KSU	Lipid metabolism disorder	5C52.Z	Phase 2	[6]
KHK-6188	DMF6CTI	Neuropathic pain	8E43.0	Phase 2	[7]
LY-2828360	DMO8IEZ	Pain	MG30-MG3Z	Phase 2	[7]
S-777469	DMZGNOJ	Atopic dermatitis	EA80	Phase 2	[8]
Vicasinabin	DMF16CU	Diabetic retinopathy	9B71.0	Phase 2	[9]
NTRX-07	DMF8AHP	Alzheimer disease	8A20	Phase 1	[10]
Tedalinab	DM58J7E	Pain	MG30-MG3Z	Phase 1	[11]

34 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,3,5-triazine derivative 1	DMLD7JU	N. A.	N. A.	Patented	[12]
2-cycloalkyl resorcinol cannabinoid ligand derivative 1	DMLXQET	N. A.	N. A.	Patented	[12]
2-cycloalkyl resorcinol cannabinoid ligand derivative 2	DMB65TO	N. A.	N. A.	Patented	[12]
Adamantyl derivative 1	DMD94MP	N. A.	N. A.	Patented	[12]
Carbazole-3-carboxamide analog 1	DM3B5RS	N. A.	N. A.	Patented	[12]
Cyano(dimethyl)methyl isoxazoles and [1,3,4]-thiadiazoles derivative 1	DMMX1ZE	N. A.	N. A.	Patented	[12]
Cyano(dimethyl)methyl isoxazoles and [1,3,4]-thiadiazoles derivative 2	DM6GTDM	N. A.	N. A.	Patented	[12]
Isoquinoline derivative 1	DMR0Y3K	Neuropathic pain	8E43.0	Patented	[12]
Isoquinoline derivative 2	DMRHBLD	Neuropathic pain	8E43.0	Patented	[12]
Isoquinoline derivative 3	DM4R1MK	Neuropathic pain	8E43.0	Patented	[12]
JWH-015	DMGTSCP	Organ transplant rejection	NE84	Patented	[1]
N,N-methylenebis-2-phenylacetamide and benzenesulfonamide derivative 1	DMEXPAU	Osteoporosis	FB83.0	Patented	[12]
N,N-methylenebis-2-phenylacetamide and benzenesulfonamide derivative 2	DMD4CU5	Osteoporosis	FB83.0	Patented	[12]
N,N-methylenebis-2-phenylacetamide and benzenesulfonamide derivative 3	DMM78VS	Osteoporosis	FB83.0	Patented	[12]
Phytocannabinoid/aminoalkylindole derivative 1	DMM9F8D	N. A.	N. A.	Patented	[12]
Phytocannabinoid/aminoalkylindole derivative 2	DMOXJ7Q	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-11	DMIX90M	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-12	DMR9GLW	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-13	DMNKH07	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-19	DMYMTSL	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-2	DMBOX0K	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-25	DMKZF8E	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-27	DMTJHC2	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-28	DM9ZF3P	Endometriosis	GA10	Patented	[12]
PMID27215781-Compound-29	DMDJM1Y	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-30	DM7USO9	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-31	DMJMO72	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-32	DM7IYRM	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-33	DMX4W2R	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-34	DMTAZBC	N. A.	N. A.	Patented	[12]
PMID27215781-Compound-37	DM0L68P	Prostate cancer	2C82.0	Patented	[12]
PMID27215781-Compound-4	DMRU0BL	N. A.	N. A.	Patented	[12]
Tricyclic phytocannabinoid derivative 1	DM94NZF	Neuropathic pain	8E43.0	Patented	[12]
Tricyclic phytocannabinoid derivative 2	DM7YVQL	Neuropathic pain	8E43.0	Patented	[12]

7 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
KN-38-7271	DMN4BIA	Ischemia	8B10-8B11	Discontinued in Phase 2	[13]
PRS-211375 iv	DMHDP9R	Pain	MG30-MG3Z	Discontinued in Phase 2	[14]
TAK-937	DM13YN0	Cerebrovascular ischaemia	8B1Z	Discontinued in Phase 1	[15]
AM-577	DMOIWFM	Pain	MG30-MG3Z	Terminated	[16]
PRS-639058	DMNK2I0	Neuropathic pain	8E43.0	Terminated	[17]
PXS-2076	DM1AXZ6	Rheumatoid arthritis	FA20	Terminated	[18]
WIN-55212-2	DMACBIW	N. A.	N. A.	Terminated	[19]

171 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(1R,2R)-N-Arachidonoylcyclopropanolamide	DMYLPV1	Discovery agent	N.A.	Investigative	[20]
(1R,2S)-N-Arachidonoylcyclopropanolamide	DM39AFU	Discovery agent	N.A.	Investigative	[20]
(1R,2S)-N-Oleoylcyclopropanolamide	DMITW5P	Discovery agent	N.A.	Investigative	[20]
(1S,2S)-N-Arachidonoylcyclopropanolamide	DMKA0ON	Discovery agent	N.A.	Investigative	[20]
(1S,2S)-N-Oleoylcyclopropanolamide	DMIV2OY	Discovery agent	N.A.	Investigative	[20]
(2R)-N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX)	DMXPQU6	Discovery agent	N.A.	Investigative	[21]
(2R)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX)	DMX0YIV	Discovery agent	N.A.	Investigative	[21]
(2S)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX)	DMRCMIT	Discovery agent	N.A.	Investigative	[21]
(4-benzhydrylpiperazin-1-yl)(cyclohexyl)methanone	DM1XY7C	Discovery agent	N.A.	Investigative	[22]
(E)-N-(3,5-dimethoxyphenethyl)undec-2-enamide	DM9WHD2	Discovery agent	N.A.	Investigative	[23]
(E)-N-(4-methoxyphenethyl)undec-2-enamide	DML6PJD	Discovery agent	N.A.	Investigative	[23]
(E)-N-(4-methoxyphenyl)undec-2-enamide	DM1PCEM	Discovery agent	N.A.	Investigative	[23]
1,4-dihydroindeno[1,2-c]-pyrazole	DMMGP9X	Discovery agent	N.A.	Investigative	[24]
2'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol	DMTP3LD	Discovery agent	N.A.	Investigative	[25]
2-(2-Methoxybenzyl)-3H-benzo[f]chromen-3-one	DM9Z8V5	Discovery agent	N.A.	Investigative	[26]
3'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol	DMJ7Y3H	Discovery agent	N.A.	Investigative	[25]
3,4-diarylpyrazoline derivative	DM8R03D	Discovery agent	N.A.	Investigative	[27]
3-benzoyl-1-pentyl-1,4-dihydroquinolin-4-one	DMHXRQL	Discovery agent	N.A.	Investigative	[28]
3-Benzyl-5-isopropyl-8-methylchromen-2-one	DMKZDYP	Discovery agent	N.A.	Investigative	[26]
4'-(1,1-dimethyl-heptyl)-3,5-dimethyl-biphenyl	DMUMD8L	Discovery agent	N.A.	Investigative	[25]
4'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol	DMQ6EBR	Discovery agent	N.A.	Investigative	[25]
4-(1,1-dimethyl-heptyl)-2'-methoxy-biphenyl-2-ol	DMV4QRF	Discovery agent	N.A.	Investigative	[25]
4-(1,1-dimethyl-heptyl)-3'-methoxy-biphenyl-2-ol	DM5BN41	Discovery agent	N.A.	Investigative	[25]
4-benzhydryl-N-butylpiperazine-1-carboxamide	DMVSNPB	Discovery agent	N.A.	Investigative	[22]
4-benzhydryl-N-cyclohexylpiperazine-1-carboxamide	DMASO86	Discovery agent	N.A.	Investigative	[22]
5-(1,1-dimethyl-heptyl)-2-pyridin-3-yl-phenol	DMS31H9	Discovery agent	N.A.	Investigative	[25]
5-Biphenyl-4-ylmethyl-1-isobutyl-1H-tetrazole	DM6W0QI	Discovery agent	N.A.	Investigative	[29]
5-Biphenyl-4-ylmethyl-2-isobutyl-2H-tetrazole	DMCPIK5	Discovery agent	N.A.	Investigative	[29]
5-Methoxy-3-(2-methoxybenzyl)-2H-chromen-2-one	DMW9D30	Discovery agent	N.A.	Investigative	[26]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX)	DM0C1FX	Discovery agent	N.A.	Investigative	[21]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-((R)-1-HYDROXYETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX)	DM1N46J	Discovery agent	N.A.	Investigative	[21]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(1-HYDROXY-2-METHYLPROPAN-2-YL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX)	DM5H4KE	Discovery agent	N.A.	Investigative	[21]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(HYDROXYMETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX)	DMEJ83H	Ovarian cancer	2C73	Investigative	[21]
A-796260	DMHFPRJ	Pain	MG30-MG3Z	Investigative	[30]
AM-1241	DMFVGXW	Discovery agent	N.A.	Investigative	[30]
AM-1710	DMO7QUP	Discovery agent	N.A.	Investigative	[31]
AM-1714	DMW9ERM	Discovery agent	N.A.	Investigative	[31]
AM-1715	DMKJQZ4	Discovery agent	N.A.	Investigative	[31]
AM-281	DMOKN27	Discovery agent	N.A.	Investigative	[26]
AM-404	DMBK9PS	Discovery agent	N.A.	Investigative	[32]
AM-411	DMU3Y4J	Discovery agent	N.A.	Investigative	[33]
AM-4768	DMETXA8	Discovery agent	N.A.	Investigative	[31]
AM-630	DM7R605	Discovery agent	N.A.	Investigative	[34]
AR-XYZ	DMWHUKZ	Inflammation	1A00-CA43.1	Investigative	[18]
Cis-N-oleoylcyclopropanolamide	DM7TU1I	N. A.	N. A.	Investigative	[20]
DELTA 8-TETRAHYDROCANNOBINOL	DM5ARHI	Discovery agent	N.A.	Investigative	[35]
Dodeca-2E,4E-dienoic acid isobutylamide	DMEKU71	Discovery agent	N.A.	Investigative	[36]
GNF-PF-5188	DMVI4JG	Discovery agent	N.A.	Investigative	[37]
HU-433	DMPLG4R	Osteoporosis	FB83.0	Investigative	[18]
JWH-051	DMYX30S	Pain	MG30-MG3Z	Investigative	[18]
JWH-120	DM7JQDS	Discovery agent	N.A.	Investigative	[37]
JWH-133	DM1DEYU	Discovery agent	N.A.	Investigative	[38]
JWH-145	DMZQ31O	Discovery agent	N.A.	Investigative	[39]
JWH-146	DMU7E6A	Discovery agent	N.A.	Investigative	[39]
JWH-147	DMEX9GV	Discovery agent	N.A.	Investigative	[39]
JWH-150	DM86OZD	Discovery agent	N.A.	Investigative	[39]
JWH-151	DMGPN61	Discovery agent	N.A.	Investigative	[37]
JWH-156	DMWGSQO	Discovery agent	N.A.	Investigative	[39]
JWH-167	DMLDOYV	Discovery agent	N.A.	Investigative	[40]
JWH-201	DMC2XSU	Discovery agent	N.A.	Investigative	[40]
JWH-202	DMQU2SV	Discovery agent	N.A.	Investigative	[40]
JWH-203	DMEJ8YA	Discovery agent	N.A.	Investigative	[40]
JWH-204	DMDTILC	Discovery agent	N.A.	Investigative	[40]
JWH-205	DMKIR63	Discovery agent	N.A.	Investigative	[40]
JWH-206	DMGFSQB	Discovery agent	N.A.	Investigative	[40]
JWH-207	DMF70IM	Discovery agent	N.A.	Investigative	[40]
JWH-208	DMLYHUN	Discovery agent	N.A.	Investigative	[40]
JWH-209	DMDXCIV	Discovery agent	N.A.	Investigative	[40]
JWH-229	DMMKYGP	Discovery agent	N.A.	Investigative	[37]
JWH-237	DMRQOL5	Discovery agent	N.A.	Investigative	[40]
JWH-243	DMGD73A	Discovery agent	N.A.	Investigative	[39]
JWH-244	DMETAOU	Discovery agent	N.A.	Investigative	[39]
JWH-245	DMC5RZ9	Discovery agent	N.A.	Investigative	[39]
JWH-246	DMGTEYB	Discovery agent	N.A.	Investigative	[39]
JWH-248	DMURL8D	Discovery agent	N.A.	Investigative	[40]
JWH-249	DMTOUCL	Discovery agent	N.A.	Investigative	[40]
JWH-250	DMWVS5X	Discovery agent	N.A.	Investigative	[40]
JWH-251	DMOJAUI	Discovery agent	N.A.	Investigative	[40]
JWH-252	DM6IWCZ	Discovery agent	N.A.	Investigative	[40]
JWH-253	DML1UMX	Discovery agent	N.A.	Investigative	[40]
JWH-268	DM07XBG	Discovery agent	N.A.	Investigative	[37]
JWH-292	DM5FAUY	Discovery agent	N.A.	Investigative	[39]
JWH-293	DMCK1XR	Discovery agent	N.A.	Investigative	[39]
JWH-294	DMTMF8X	Discovery agent	N.A.	Investigative	[41]
JWH-295	DMUMJGD	Discovery agent	N.A.	Investigative	[41]
JWH-296	DMNRXJU	Discovery agent	N.A.	Investigative	[41]
JWH-297	DM4A761	Discovery agent	N.A.	Investigative	[41]
JWH-302	DMI7LF1	Discovery agent	N.A.	Investigative	[40]
JWH-303	DMCLAHR	Discovery agent	N.A.	Investigative	[40]
JWH-305	DM36W9M	Discovery agent	N.A.	Investigative	[40]
JWH-306	DMPDJKG	Discovery agent	N.A.	Investigative	[40]
JWH-307	DM23RUZ	Discovery agent	N.A.	Investigative	[39]
JWH-308	DMV5ASE	Discovery agent	N.A.	Investigative	[39]
JWH-309	DMTV1B9	Discovery agent	N.A.	Investigative	[39]
JWH-311	DMLABGW	Discovery agent	N.A.	Investigative	[40]
JWH-312	DMYIGCU	Discovery agent	N.A.	Investigative	[40]
JWH-313	DMWBHZL	Discovery agent	N.A.	Investigative	[40]
JWH-314	DMCEKNJ	Discovery agent	N.A.	Investigative	[40]
JWH-315	DMWHN56	Discovery agent	N.A.	Investigative	[40]
JWH-323	DM63LOX	Discovery agent	N.A.	Investigative	[41]
JWH-324	DMJ2EI9	Discovery agent	N.A.	Investigative	[42]
JWH-325	DMHNTZ8	Discovery agent	N.A.	Investigative	[41]
JWH-337	DMK3DUZ	Discovery agent	N.A.	Investigative	[41]
JWH-342	DMTSZFB	Discovery agent	N.A.	Investigative	[41]
JWH-343	DMEU1NS	Discovery agent	N.A.	Investigative	[41]
JWH-344	DM6VZ3T	Discovery agent	N.A.	Investigative	[41]
JWH-345	DML53SK	Discovery agent	N.A.	Investigative	[41]
JWH-346	DMHNILP	Discovery agent	N.A.	Investigative	[39]
JWH-347	DMK2NQ1	Discovery agent	N.A.	Investigative	[39]
JWH-348	DMQIVPK	Discovery agent	N.A.	Investigative	[39]
JWH-363	DMFLB1Z	Discovery agent	N.A.	Investigative	[39]
JWH-364	DMP6C4D	Discovery agent	N.A.	Investigative	[39]
JWH-365	DM2ZXBR	Discovery agent	N.A.	Investigative	[39]
JWH-366	DMSNLFJ	Discovery agent	N.A.	Investigative	[39]
JWH-367	DM7ZF2K	Discovery agent	N.A.	Investigative	[39]
JWH-368	DMK0FNX	Discovery agent	N.A.	Investigative	[39]
JWH-369	DMPDTWY	Discovery agent	N.A.	Investigative	[39]
JWH-370	DM6IG7P	Discovery agent	N.A.	Investigative	[39]
JWH-371	DME0URP	Discovery agent	N.A.	Investigative	[39]
JWH-372	DM9D3GM	Discovery agent	N.A.	Investigative	[39]
JWH-373	DMWP84R	Discovery agent	N.A.	Investigative	[39]
JWH-385	DMU1HA7	Discovery agent	N.A.	Investigative	[41]
JWH-392	DMMUBIF	Discovery agent	N.A.	Investigative	[41]
JWH-401	DMFL6B9	Discovery agent	N.A.	Investigative	[41]
JWH-402	DM8TQIF	Discovery agent	N.A.	Investigative	[41]
JWH-403	DMRG1VI	Discovery agent	N.A.	Investigative	[41]
JWH-404	DM3KWER	Discovery agent	N.A.	Investigative	[41]
JWH-405	DM57TN3	Discovery agent	N.A.	Investigative	[41]
JWH-406	DMNP7GD	Discovery agent	N.A.	Investigative	[41]
JWH-407	DMZQ0V9	Discovery agent	N.A.	Investigative	[41]
JWH-440	DM89602	Discovery agent	N.A.	Investigative	[42]
JWH-441	DM7R1XS	Discovery agent	N.A.	Investigative	[42]
JWH-442	DMX6F1L	Discovery agent	N.A.	Investigative	[42]
KM-233	DMZSYKC	Discovery agent	N.A.	Investigative	[43]
KM-233-M	DMK4IBO	Discovery agent	N.A.	Investigative	[43]
L-759,633	DMQJNDX	Discovery agent	N.A.	Investigative	[18]
L-759,656	DM5SOR4	Discovery agent	N.A.	Investigative	[18]
MDA-19	DMEUWB8	Neuropathic pain	8E43.0	Investigative	[18]
N-(1H-indazol-5-yl)icosa-5,8,11,14-tetraenamide	DM63YJV	Discovery agent	N.A.	Investigative	[32]
N-(2-chloroethyl)icosa-5,8,11,14-tetraenamide	DMU5R2O	Discovery agent	N.A.	Investigative	[34]
N-(3,3-Diphenyl)propyl-2,2-diphenylacetamide	DMAXLVQ	Discovery agent	N.A.	Investigative	[44]
N-(3-Phenyl)propyl-2-(4-bromophenylacetamide)	DMSNF7W	Discovery agent	N.A.	Investigative	[44]
N-(4-hydroxybenzyl)icosa-5,8,11,14-tetraenamide	DM7O5WS	Discovery agent	N.A.	Investigative	[32]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX)	DMP7UZB	Discovery agent	N.A.	Investigative	[21]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXY-2,2-DIMETHYLPROPANAMIDE (ENANTIOMERIC MIX)	DMDPXUA	Discovery agent	N.A.	Investigative	[21]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX)	DMSX5DI	Discovery agent	N.A.	Investigative	[21]
N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXY-2-METHYLPROPANAMIDE (ENANTIOMERIC MIX)	DM5F27T	Discovery agent	N.A.	Investigative	[21]
N-(7-(2-CHLOROPHENYL)-6-(4-CHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX)	DMO3Y0B	Discovery agent	N.A.	Investigative	[21]
N-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine	DMF9U2O	Discovery agent	N.A.	Investigative	[45]
N-arachidonoyl-O-(2-hydroxyethyl)hydroxylamine	DM49HIO	Discovery agent	N.A.	Investigative	[45]
N-benzyl-4-bromo-3-(morpholinosulfonyl)benzamide	DMUNL5Q	Discovery agent	N.A.	Investigative	[46]
N-oleoyl-N-(2-hydroxyethyl)hydroxylamine	DMRU21X	Discovery agent	N.A.	Investigative	[45]
N-oleoyl-O-(2-hydroxyethyl)hydroxylamine	DMZM3CH	Discovery agent	N.A.	Investigative	[45]
N-[6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-YL]-4,4,4-TRIFLUORO-3-HYDROXYBUTANAMIDE (DIASTEREOMERIC MIX)	DMVY7RX	Discovery agent	N.A.	Investigative	[47]
N1-(4-bromophenyl)-N2,N2-dipentylphthalamide	DMCH7GO	Discovery agent	N.A.	Investigative	[37]
NAPHTHYRIDINONE	DM0OEGV	Discovery agent	N.A.	Investigative	[48]
O-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine	DMWZXH6	Discovery agent	N.A.	Investigative	[45]
O-oleoyl-N-(2-hydroxyethyl)hydroxylamine	DMDR95N	Discovery agent	N.A.	Investigative	[45]
PRAVADOLINE	DM3XRJT	Discovery agent	N.A.	Investigative	[49]
Rac-cis-N-arachidonoylcyclopropanolamide	DMR8L6O	Discovery agent	N.A.	Investigative	[20]
Rac-trans-N-oleoylcyclopropanolamide	DM9DA8O	N. A.	N. A.	Investigative	[20]
RQ-00202730	DMTD3O8	Inflammatory bowel disease	DD72	Investigative	[18]
Sch-036	DMIKJLP	Immune System disease	4A01-4B41	Investigative	[18]
SCH-225336	DMH7EWZ	Discovery agent	N.A.	Investigative	[50]
SCH-356036	DMOEB8M	Discovery agent	N.A.	Investigative	[51]
SR144528	DMBRVXY	Discovery agent	N.A.	Investigative	[52]
VER-156084	DMFZMA2	Neuropathic pain	8E43.0	Investigative	[53]
VER-156085	DMCRHOA	Discovery agent	N.A.	Investigative	[53]
[3H]CP55940	DMU7FC5	Discovery agent	N.A.	Investigative	[54]
[3H]HU-243	DM8YUW6	Discovery agent	N.A.	Investigative	[55]
[3H]WIN55212-2	DM0TRAZ	Discovery agent	N.A.	Investigative	[56]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Atopic dermatitis	EA90	Skin	3.55E-03	0.05	0.33
Rheumatoid arthritis	FA20	Synovial tissue	7.23E-02	0.6	1.36
Ovarian cancer	2C82	Ovarian tissue	3.82E-02	-0.43	-1.18
Osteoporosis	FA20	Bone marrow	5.87E-02	0.66	3.11

References

• [1] Posttraining activation of CB1 cannabinoid receptors in the CA1 region of the dorsal hippocampus impairs object recognition long-term memory. Neurobiol Learn Mem. 2008 Sep;90(2):374-81.
• [2] Novel 1',1'-chain substituted hexahydrocannabinols: 9-hydroxy-3-(1-hexyl-cyclobut-1-yl)-hexahydrocannabinol (AM2389) a highly potent cannabinoid r... J Med Chem. 2010 Oct 14;53(19):6996-7010.
• [3] The agonist binding mechanism of human CB2 receptor studied by molecular dynamics simulation, free energy calculation and 3D-QSAR studies. Yao Xue Xue Bao. 2013 Sep;48(9):1436-49.
• [4] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [5] The cannabinoid CB1 receptor-selective phytocannabinoid beta-caryophyllene exerts analgesic effects in mouse models of inflammatory and neuropathic pain. Eur Neuropsychopharmacol. 2014 Apr;24(4):608-20.
• [6] Company report (Gwpharm)
• [7] Recent Development of CB2 Selective and Peripheral CB1/CB2 Cannabinoid Receptor Ligands. Current Medicinal Chemistry . 10/2013; 21(2).
• [8] Emerging drugs for atopic dermatitis. Expert Opin Emerg Drugs. 2009 Mar;14(1):165-79.
• [9] Clinical pipeline report, company report or official report of Roche
• [10] MDA7: a novel selective agonist for CB2 receptors that prevents allodynia in rat neuropathic pain models. Br J Pharmacol. 2008 Dec;155(7):1104-16.
• [11] Cannabinoid CB2 receptor (CNR2). SciBX 3(46); doi:10.1038/scibx.2010.1384. Dec. 2 2010
• [12] Cannabinoid receptor 2 (CB2) agonists and antagonists: a patent update.Expert Opin Ther Pat. 2016 Jul;26(7):843-56.
• [13] BAY 38-7271: a novel highly selective and highly potent cannabinoid receptor agonist for the treatment of traumatic brain injury.CNS Drug Rev.2003 Winter;9(4):343-58.
• [14] Brain CB2 Receptors: Implications for Neuropsychiatric Disorders. Pharmaceuticals (Basel) 2010 August; 3(8): 2517-2553.
• [15] Cerebroprotective effects of TAK-937, a cannabinoid receptor agonist, on ischemic brain damage in middle cerebral artery occluded rats and non-human primates. Brain Res. 2012 Jan 9;1430:93-100.
• [16] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018288)
• [17] Targeting CB2 receptors and the endocannabinoid system for the treatment of pain. Brain Res Rev. 2009 April; 60(1): 255-266.
• [18] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 57).
• [19] Synthesis and cannabinoid activity of 1-substituted-indole-3-oxadiazole derivatives: novel agonists for the CB1 receptor. Eur J Med Chem. 2008 Mar;43(3):513-39.
• [20] Conformationally constrained fatty acid ethanolamides as cannabinoid and vanilloid receptor probes. J Med Chem. 2009 May 14;52(9):3001-9.
• [21] Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3750-4.
• [22] Discovery of benzhydrylpiperazine derivatives as CB1 receptor inverse agonists via privileged structure-based approach. Eur J Med Chem. 2010 Mar;45(3):1133-9.
• [23] New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. Bioorg Med Chem Lett. 2006 Jan 1;16(1):138-41.
• [24] Tricyclic pyrazoles. 3. Synthesis, biological evaluation, and molecular modeling of analogues of the cannabinoid antagonist 8-chloro-1-(2',4'-dichl... J Med Chem. 2005 Nov 17;48(23):7351-62.
• [25] Biaryl cannabinoid mimetics--synthesis and structure-activity relationship. Bioorg Med Chem Lett. 2007 Jul 1;17(13):3652-6.
• [26] Synthesis and pharmacological evaluation of coumarin derivatives as cannabinoid receptor antagonists and inverse agonists. Bioorg Med Chem. 2009 Apr 1;17(7):2842-51.
• [27] Novel 3,4-diarylpyrazolines as potent cannabinoid CB1 receptor antagonists with lower lipophilicity. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4794-8.
• [28] Pharmacomodulations around the 4-oxo-1,4-dihydroquinoline-3-carboxamides, a class of potent CB2-selective cannabinoid receptor ligands: consequence... J Med Chem. 2007 Nov 1;50(22):5471-84.
• [29] New tetrazole-based selective anandamide uptake inhibitors. Bioorg Med Chem Lett. 2008 May 1;18(9):2820-4.
• [30] Indol-3-ylcycloalkyl ketones: effects of N1 substituted indole side chain variations on CB(2) cannabinoid receptor activity. J Med Chem. 2010 Jan 14;53(1):295-315.
• [31] Cannabilactones: a novel class of CB2 selective agonists with peripheral analgesic activity. J Med Chem. 2007 Dec 27;50(26):6493-500.
• [32] New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. J Med Chem. 2008 Dec 25;51(24):7800-5.
• [33] Heteroadamantyl cannabinoids. J Med Chem. 2010 Aug 12;53(15):5656-66.
• [34] New 1,8-naphthyridine and quinoline derivatives as CB2 selective agonists. Bioorg Med Chem Lett. 2007 Dec 1;17(23):6505-10.
• [35] Bornyl- and isobornyl-Delta8-tetrahydrocannabinols: a novel class of cannabinergic ligands. J Med Chem. 2008 Oct 23;51(20):6393-9.
• [36] Self-assembling cannabinomimetics: supramolecular structures of N-alkyl amides. J Nat Prod. 2007 Jun;70(6):1010-5.
• [37] Discovery of novel CB2 receptor ligands by a pharmacophore-based virtual screening workflow. J Med Chem. 2009 Jan 22;52(2):369-78.
• [38] Design, synthesis, and biological evaluation of new 1,8-naphthyridin-4(1H)-on-3-carboxamide and quinolin-4(1H)-on-3-carboxamide derivatives as CB2 ... J Med Chem. 2006 Oct 5;49(20):5947-57.
• [39] 1-Alkyl-2-aryl-4-(1-naphthoyl)pyrroles: new high affinity ligands for the cannabinoid CB1 and CB2 receptors. Bioorg Med Chem Lett. 2006 Oct 15;16(20):5432-5.
• [40] 1-Pentyl-3-phenylacetylindoles, a new class of cannabimimetic indoles. Bioorg Med Chem Lett. 2005 Sep 15;15(18):4110-3.
• [41] Synthesis and pharmacology of 1-deoxy analogs of CP-47,497 and CP-55,940. Bioorg Med Chem. 2008 Jan 1;16(1):322-35.
• [42] Synthesis and pharmacology of 1-methoxy analogs of CP-47,497. Bioorg Med Chem. 2010 Aug 1;18(15):5475-82.
• [43] Exploring the substituent effects on a novel series of C1'-dimethyl-aryl Delta8-tetrahydrocannabinol analogs. Bioorg Med Chem. 2008 Jul 1;16(13):6489-500.
• [44] Novel sterically hindered cannabinoid CB1 receptor ligands. Bioorg Med Chem. 2008 Aug 1;16(15):7510-5.
• [45] Oxyhomologues of anandamide and related endolipids: chemoselective synthesis and biological activity. J Med Chem. 2006 Apr 6;49(7):2333-8.
• [46] CB2 selective sulfamoyl benzamides: optimization of the amide functionality. Bioorg Med Chem Lett. 2009 Jan 15;19(2):309-13.
• [47] Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carbox... J Med Chem. 2010 May 27;53(10):4028-37.
• [48] Synthesis of functionalized 1,8-naphthyridinones and their evaluation as novel, orally active CB1 receptor inverse agonists. Bioorg Med Chem Lett. 2006 Feb;16(3):681-5.
• [49] Morpholinoalkylindenes as antinociceptive agents: Novel cannabinoid receptor agonists, Bioorg. Med. Chem. Lett. 5(4):381-386 (1995).
• [50] Radiosynthesis of novel carbon-11-labeled triaryl ligands for cannabinoid-type 2 receptor. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1565-8.
• [51] Synthesis and SAR of novel imidazoles as potent and selective cannabinoid CB2 receptor antagonists with high binding efficiencies. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1084-9.
• [52] Antinociceptive activity of the endogenous fatty acid amide, palmitylethanolamide. Eur J Pharmacol. 2001 May 11;419(2-3):191-8.
• [53] Fatty acid amide hydrolase inhibitors. Surprising selectivity of chiral azetidine ureas. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4241-4.
• [54] Signaling pathway associated with stimulation of CB2 peripheral cannabinoid receptor. Involvement of both mitogen-activated protein kinase and induction of Krox-24 expression. Eur J Biochem. 1996 May1;237(3):704-11.
• [55] The peripheral cannabinoid receptor: adenylate cyclase inhibition and G protein coupling. FEBS Lett. 1995 Nov 13;375(1-2):143-7.
• [56] Activation of the human peripheral cannabinoid receptor results in inhibition of adenylyl cyclase. Mol Pharmacol. 1995 Aug;48(2):352-61.