Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTO9X1H)

• DTT Name: 5-HT 7 receptor (HTR7)
• Synonyms: Serotonin receptor 7; 5HT7; 5-hydroxytryptamine receptor 7; 5-HT7 receptor; 5-HT7; 5-HT-X; 5-HT-7
• Gene Name: HTR7
• DTT Type: Clinical trial target; [1]
• Related Disease:
  Depression [ICD-11: 6A70-6A7Z]
  Mild neurocognitive disorder [ICD-11: 6D71]
  Alzheimer disease [ICD-11: 8A20]
  Attention deficit hyperactivity disorder [ICD-11: 6A05]
  Bipolar disorder [ICD-11: 6A60]
  Parkinsonism [ICD-11: 8A00]
  Schizophrenia [ICD-11: 6A20]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: 5HT7R_HUMAN
• TTD ID: T79062
• Sequence:
  MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
  DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
  VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
  YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
  IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
  ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
  IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
  LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
• Function: The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen.
• KEGG Pathway:
  Ras signaling pathway (hsa04014)
  Calcium signaling pathway (hsa04020)
  Neuroactive ligand-receptor interaction (hsa04080)
  Serotonergic synapse (hsa04726)
• Reactome Pathway:
  G alpha (s) signalling events (R-HSA-418555)
  Serotonin receptors (R-HSA-390666)

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AVN-101	DMOGFNI	Cognitive impairment	6D71	Phase 2	[2]
JNJ-18038683	DMV1T59	Major depressive disorder	6A70.3	Phase 2	[3]
RP5063	DMKUE8O	Schizophrenia	6A20	Phase 2	[4]
ATI-9242	DM6GKMU	Schizophrenia	6A20	Phase 1	[5]

4 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4-oxadiazole derivative 1	DMWFHKR	N. A.	N. A.	Patented	[6]
Carbamide derivative 2	DMW5GI3	N. A.	N. A.	Patented	[6]
PMID30124346-Compound-13TABLE4	DMHTJVA	Attention deficit hyperactivity disorder	6A05.Z	Patented	[7]
PMID30124346-Compound-34TABLE4	DM2G3VE	Attention deficit hyperactivity disorder	6A05.Z	Patented	[7]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
SB-269970	DM8WTGA	Sleep-wake disorder	7A00-7B2Z	Terminated	[8], [9]

63 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[10]
(2-biphenyl-3-yl-ethyl)-dimethyl-amine	DMTW0GD	Discovery agent	N.A.	Investigative	[11]
(R)-8-phenyl-N,N-dipropylchroman-3-amine	DMCY76E	Discovery agent	N.A.	Investigative	[12]
1-(2-Methoxy-phenyl)-piperazine	DM3M4RA	Discovery agent	N.A.	Investigative	[13]
1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine	DMX5N3V	Discovery agent	N.A.	Investigative	[14]
1-naphthylpiperazine	DM6BIWK	Discovery agent	N.A.	Investigative	[1], [15]
2-(1-o-tolyl-1H-pyrrol-3-yl)ethanamine	DMY35HG	Discovery agent	N.A.	Investigative	[11]
2-(2'-methyl-biphenyl-3-yl)-ethylamine	DM7HN4Z	Discovery agent	N.A.	Investigative	[11]
2-(2-Bromophenoxy)-N,N-dimethylethanamine	DMHBE0X	Discovery agent	N.A.	Investigative	[12]
2-(2-Bromophenylthio)-N,N-dimethylethanamine	DMHJMUX	Discovery agent	N.A.	Investigative	[12]
2-(Biphenyl-2-yloxy)-N,N-dimethylethanamine	DM0C5O3	Discovery agent	N.A.	Investigative	[12]
2-(Biphenyl-2-ylthio)-N,N-dimethylethanamine	DM9XZSC	Discovery agent	N.A.	Investigative	[12]
2-bromo-LSD	DMOYCWU	Discovery agent	N.A.	Investigative	[16]
2-[1-(2-Chloro-phenyl)-1H-pyrrol-2-yl]-ethylamine	DMSW89U	Discovery agent	N.A.	Investigative	[17]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[18]
5,6-dichloro-3,4-dihydroquinazolin-2-amine	DMN1S35	Discovery agent	N.A.	Investigative	[19]
5-chloro-3,4-dihydroquinazolin-2-amine	DMKEFJ0	Discovery agent	N.A.	Investigative	[19]
5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine	DMGDTNI	Discovery agent	N.A.	Investigative	[19]
5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine	DM7FZU2	Discovery agent	N.A.	Investigative	[19]
5-CT	DM260KD	Discovery agent	N.A.	Investigative	[16]
8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine	DMK6U2V	Discovery agent	N.A.	Investigative	[19]
AS-19	DMASE5O	Discovery agent	N.A.	Investigative	[20]
bufotenine	DMD1SY9	Discovery agent	N.A.	Investigative	[16]
Cyamemazine	DMZ6YPV	Discovery agent	N.A.	Investigative	[21]
dihydroergocryptine	DMDW2NL	Discovery agent	N.A.	Investigative	[16]
dipropyl-5-CT	DM9VKXC	Discovery agent	N.A.	Investigative	[22]
Disulergine	DM6TVAX	Discovery agent	N.A.	Investigative	[15]
DM-1451	DMM0VDK	Discovery agent	N.A.	Investigative	[23]
DR-4004	DMW8ORN	Discovery agent	N.A.	Investigative	[15]
E55888	DM0O8KR	Discovery agent	N.A.	Investigative	[24]
EDMT	DMS3AXK	Discovery agent	N.A.	Investigative	[25]
Elaidoylamide	DMP8VDT	Discovery agent	N.A.	Investigative	[26]
FALCARINDIOL	DMLOV18	Discovery agent	N.A.	Investigative	[27]
fluperlapine	DM9KIPU	Discovery agent	N.A.	Investigative	[28]
IMPERATORIN	DMVLW6R	Discovery agent	N.A.	Investigative	[27]
LP-12	DM8ZR17	Discovery agent	N.A.	Investigative	[29]
LP-211	DMKDGLA	Discovery agent	N.A.	Investigative	[30]
LP-44	DM0C3SF	Discovery agent	N.A.	Investigative	[29]
m-chlorophenylpiperazine	DMM1J2D	Discovery agent	N.A.	Investigative	[13]
MESULERGINE	DMKGWAH	Discovery agent	N.A.	Investigative	[31]
METHIOTHEPIN	DMMC0I7	Discovery agent	N.A.	Investigative	[32]
MPDT	DMYX31S	Discovery agent	N.A.	Investigative	[25]
N,N-dimethyl-2-(2'-methylbiphenyl-3-yl)ethanamine	DM1DZEL	Discovery agent	N.A.	Investigative	[12]
N-methyl-Pip-F-homoF-vinyl sulfonyl phenyl (N-methyl-Pip-F-hF-VS phi)	DMDAN0K	Discovery agent	N.A.	Investigative	[33]
OPC 4392	DMQOJY2	Discovery agent	N.A.	Investigative	[23]
P-hydroxyphenethyl trans-ferulate	DMPS1Y2	Discovery agent	N.A.	Investigative	[27]
pirenperone	DM9T2G3	Discovery agent	N.A.	Investigative	[22]
SB 269970-A	DMFHUGC	Discovery agent	N.A.	Investigative	[33]
SB-258719	DMO01AG	Discovery agent	N.A.	Investigative	[15]
SB-258741	DM0HK6L	Discovery agent	N.A.	Investigative	[15]
SB-271046	DM5VJAF	Discovery agent	N.A.	Investigative	[34]
SB-656104	DMVOIL5	Discovery agent	N.A.	Investigative	[15]
SEL-73	DMFKE6C	Psychiatric disorder	6E8Z	Investigative	[35]
Serotonin	DMOFCRY	Discovery agent	N.A.	Investigative	[36]
TFMPP	DMAC8TP	Discovery agent	N.A.	Investigative	[13]
UCM-5600	DMOJ4TG	Discovery agent	N.A.	Investigative	[31]
WAY-208466	DM9K2LU	Discovery agent	N.A.	Investigative	[37]
WAY-466	DMMOH51	Discovery agent	N.A.	Investigative	[38]
[125I]LSD	DMP69QG	Discovery agent	N.A.	Investigative	[39]
[3H]5-CT	DMEAHFZ	Discovery agent	N.A.	Investigative	[8]
[3H]5-HT	DMYJXV7	Discovery agent	N.A.	Investigative	[1]
[3H]LSD	DM0YJHS	Discovery agent	N.A.	Investigative	[40]
[3H]spiperone	DMWHEV8	Discovery agent	N.A.	Investigative	[15]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Major depressive disorder	6A20	Pre-frontal cortex	9.79E-01	-0.08	-0.32
Schizophrenia	6A20	Pre-frontal cortex	4.97E-02	-0.03	-0.11
Schizophrenia	6A20	Superior temporal cortex	3.78E-01	-4.84E-04	-3.66E-03

References

• [1] Cloning of a novel human serotonin receptor (5-HT7) positively linked to adenylate cyclase. J Biol Chem. 1993 Nov 5;268(31):23422-6.
• [2] AVN-101: A Multi-Target Drug Candidate for the Treatment of CNS Disorders. J Alzheimers Dis. 2016 May 25;53(2):583-620.
• [3] Selective pharmacological blockade of the 5-HT7 receptor attenuates light and 8-OH-DPAT induced phase shifts of mouse circadian wheel running activity. Front Behav Neurosci. 2015 Jan 15;8:453.
• [4] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [5] Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12.
• [6] Acyltransferase inhibitors: a patent review (2010-present).Expert Opin Ther Pat. 2015 Feb;25(2):145-58.
• [7] 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689.
• [8] [(3)H]-SB-269970--A selective antagonist radioligand for 5-HT(7) receptors. Br J Pharmacol. 2000 May;130(2):409-17.
• [9] Characterization of SB-269970-A, a selective 5-HT(7) receptor antagonist. Br J Pharmacol. 2000 Jun;130(3):539-48.
• [10] Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
• [11] Novel aminoethylbiphenyls as 5-HT7 receptor ligands. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22.
• [12] SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. Bioorg Med Chem. 2010 Mar 1;18(5):1958-67.
• [13] Molecular cloning and expression of a 5-hydroxytryptamine7 serotonin receptor subtype. J Biol Chem. 1993 Aug 25;268(24):18200-4.
• [14] The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66.
• [15] Higher-end serotonin receptors: 5-HT(5), 5-HT(6), and 5-HT(7). J Med Chem. 2003 Jul 3;46(14):2795-812.
• [16] Molecular cloning of a mammalian serotonin receptor that activates adenylate cyclase. Mol Pharmacol. 1993 Aug;44(2):229-36.
• [17] Phenylpyrroles, a new chemolibrary virtual screening class of 5-HT7 receptor ligands. Bioorg Med Chem Lett. 2005 Aug 15;15(16):3753-7.
• [18] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [19] Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61.
• [20] Discovery of aryl-biphenyl-2-ylmethylpiperazines as novel scaffolds for 5-HT(7) ligands and role of the aromatic substituents in binding to the target receptor. Bioorg Med Chem. 2013 May 1;21(9):2568-76.
• [21] Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40.
• [22] Cloning, expression and pharmacology of a truncated splice variant of the human 5-HT7 receptor (h5-HT7b). Br J Pharmacol. 1997 Sep;122(1):126-32.
• [23] Interactions of the novel antipsychotic aripiprazole (OPC-14597) with dopamine and serotonin receptor subtypes. Neuropsychopharmacology. 1999 Jun;20(6):612-27.
• [24] 5-HT7 receptor activation inhibits mechanical hypersensitivity secondary to capsaicin sensitization in mice. Pain. 2009 Feb;141(3):239-47.
• [25] 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8.
• [26] Allosteric regulation by oleamide of the binding properties of 5-hydroxytryptamine7 receptors. Biochem Pharmacol. 1999 Dec 1;58(11):1807-13.
• [27] Serotonergic activity-guided phytochemical investigation of the roots of Angelica sinensis. J Nat Prod. 2006 Apr;69(4):536-41.
• [28] Binding of typical and atypical antipsychotic agents to 5-hydroxytryptamine-6 and 5-hydroxytryptamine-7 receptors. J Pharmacol Exp Ther. 1994 Mar;268(3):1403-10.
• [29] Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21.
• [30] Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22.
• [31] Synthesis of new serotonin 5-HT7 receptor ligands. Determinants of 5-HT7/5-HT1A receptor selectivity. J Med Chem. 2009 Apr 23;52(8):2384-92.
• [32] Novel quinazolinone derivatives as 5-HT7 receptor ligands. Bioorg Med Chem. 2008 Mar 1;16(5):2570-8.
• [33] 5-HT7 receptors. Curr Drug Targets CNS Neurol Disord. 2004 Feb;3(1):81-90.
• [34] Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43.
• [35] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 12).
• [36] Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69.
• [37] Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63.
• [38] Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6.
• [39] A novel adenylyl cyclase-activating serotonin receptor (5-HT7) implicated in the regulation of mammalian circadian rhythms. Neuron. 1993 Sep;11(3):449-58.
• [40] Human serotonin 5-HT7 receptor: cloning and pharmacological characterisation of two receptor variants. FEBS Lett. 1997 Aug 25;413(3):489-94.