General Information of Drug Therapeutic Target (DTT) (ID: TTP3QRF)

DTT Name Thymidine kinase 1 (TK1)
Synonyms Thymidine kinase, cytosolic
Gene Name TK1
DTT Type
Successful target
[1]
BioChemical Class
Kinase
UniProt ID
KITH_HUMAN
TTD ID
T30081
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 2.7.1.21
Sequence
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Function
cytosol, identical protein binding, thymidine kinase activity, zinc ion binding, DNA metabolic process, nucleobase-containing compound metabolic process, protein homotetramerization, pyrimidine nucleoside salvage, thymidine metabolic process
KEGG Pathway
Pyrimidine metabolism (hsa00240 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Nucleotide metabolism (hsa01232 )
Reactome Pathway
Pyrimidine salvage (R-HSA-73614 )
G1/S-Specific Transcription (R-HSA-69205 )
BioCyc Pathway
MetaCyc:HS09657-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
DEOXYCYTIDINE DMYE5LJ Acute myeloid leukaemia 2A60 Approved [2]
Penciclovir DMOUMDV Herpes simplex labialis 1F00.01 Approved [1]
------------------------------------------------------------------------------------
8 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
TK-DLI DM26I8H Graft-versus-host disease 4B24 Preregistration [3]
FV-100 DMZARP1 Varicella zoster virus infection 1E91 Phase 3 [4]
Radiosensitizer gene therapy DMN1ZEU Pancreatic cancer 2C10 Phase 3 [5]
RP101 DMNIYSZ Infectious disease 1A00-CA43.1 Phase 2/3 [6]
HQK-1004 DM3WX0K Solid tumour/cancer 2A00-2F9Z Phase 2 [7]
Ad-OC-hsvTK/valacyclovir DM9GLHO Prostate cancer 2C82.0 Phase 1 [8]
Rilapladib DMB9861 Arteriosclerosis BD40 Phase 1 [9]
Thymidine kinase-expressing adenovirus and ganciclovir suicide gene therapy DMO8SGD Solid tumour/cancer 2A00-2F9Z Phase 1 [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Clinical Trial Drug(s)
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sitimagene ceradenovec DM0T2QV Brain cancer 2A00 Discontinued in Phase 3 [11]
------------------------------------------------------------------------------------
28 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(South)-Methanocarba-Thymidine DMT3S72 Discovery agent N.A. Investigative [1]
1-[(Z)-4-(triphenylmethoxy)-2-butenyl]thymine DMU3VWA Discovery agent N.A. Investigative [12]
1-[2-(2-triphenylmethoxyethoxy)ethyl]thymine DMDZA83 Discovery agent N.A. Investigative [12]
1-[5-(triphenylmethoxy)pentyl]thymine DMFHBJM Discovery agent N.A. Investigative [12]
1-[6-(triphenylmethoxy)hexyl]thymine DM5NVHO Discovery agent N.A. Investigative [12]
1-[7-(triphenylmethoxy)heptyl]thymine DMQ05F2 Discovery agent N.A. Investigative [12]
2'-deoxythymidine triphosphate DM9OEJT Discovery agent N.A. Investigative [1]
2'-Deoxyuridine DM1HMWA Discovery agent N.A. Investigative [2]
2-phenylamino-9-(4-hydroxy-butyl)-6-oxopurine DMW0M14 Discovery agent N.A. Investigative [13]
3'-(1,2,3-Triazol-1-yl)-3'-deoxy-beta-D-thymidine DM5UL3F Discovery agent N.A. Investigative [14]
3-(2-propyn-1-yl)thymidine DM2IYAP Discovery agent N.A. Investigative [15]
5-Bromothienyldeoxyuridine DMZ8X3H Discovery agent N.A. Investigative [1]
5-Iodo-2'-Deoxyuridine-5'-Monophosphate DMZACXG Discovery agent N.A. Investigative [1]
5-propyl-2'-deoxyuridine DM9IHV6 Discovery agent N.A. Investigative [13]
6-(Dihydroxy-Isobutyl)-Thymine DMQPTL5 Discovery agent N.A. Investigative [1]
6-Hydroxypropylthymine DMVRFU5 Discovery agent N.A. Investigative [1]
9-(4-Hydroxybutyl)-N2-Phenylguanine DMLKJD9 Discovery agent N.A. Investigative [1]
9-Hydroxypropyladenine, R-Isomer DMB9FCK Discovery agent N.A. Investigative [1]
9-Hydroxypropyladenine, S-Isomer DM8QJUH Discovery agent N.A. Investigative [1]
BVDU-MP DMI1H3Y Discovery agent N.A. Investigative [16]
Deoxythymidine DMR90HY Discovery agent N.A. Investigative [1]
Edoxudine DMC7DYX Discovery agent N.A. Investigative [13]
ITdU DMA8F4N Discovery agent N.A. Investigative [9]
L-5-(bromovinyl)deoxyuridine DMHL901 Discovery agent N.A. Investigative [13]
L-5-iodo-2'-deoxyuridine DM3Q0JL Discovery agent N.A. Investigative [13]
N2-(3-trifluoromethylphenyl)guanine DMGJEH9 Discovery agent N.A. Investigative [13]
P1-(5'-Adenosyl)P5-(5'-Thymidyl)Pentaphosphate DMM4VWD Discovery agent N.A. Investigative [6]
Thymidine-5'-Phosphate DMKM6NQ Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 28 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Prostate cancer 2C82 Prostate 1.14E-03 0.26 0.75
Neuroectodermal tumour 2C82 Nervous tissue 7.79E-76 0.42 1.38
------------------------------------------------------------------------------------

References

1 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
2 Species- or isozyme-specific enzyme inhibitors. 5. Differential effects of thymidine substituents on affinity for rat thymidine kinase isozymes. J Med Chem. 1982 Jun;25(6):644-9.
3 Company report (Takara Bio)
4 Specific recognition of the bicyclic pyrimidine nucleoside analogs, a new class of highly potent and selective inhibitors of varicella-zoster virus (VZV), by the VZV-encoded thymidine kinase. Mol Pharmacol. 2002 Feb;61(2):249-54.
5 Pronounced antitumor effects and tumor radiosensitization of double suicide gene therapy. Clin Cancer Res. 1997 Nov;3(11):2081-8.
6 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
7 Induction of the Epstein-Barr virus thymidine kinase gene with concomitant nucleoside antivirals as a therapeutic strategy for Epstein-Barr virus-associated malignancies. Curr Opin Oncol. 2001 Sep;13(5):360-7.
8 Phase I dose escalation clinical trial of adenovirus vector carrying osteocalcin promoter-driven herpes simplex virus thymidine kinase in localized and metastatic hormone-refractory prostate cancer. Hum Gene Ther. 2003 Feb 10;14(3):227-41.
9 Trichomonas vaginalis thymidine kinase: purification, characterization and search for inhibitors. Biochem J. 1998 Aug 15;334 ( Pt 1):15-22.
10 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
11 Sitimagene ceradenovec: a gene-based drug for the treatment of operable high-grade glioma. Future Oncol. 2010 Nov;6(11):1691-710.
12 N1-substituted thymine derivatives as mitochondrial thymidine kinase (TK-2) inhibitors. J Med Chem. 2006 Dec 28;49(26):7766-73.
13 Sensitivity of monkey B virus (Cercopithecine herpesvirus 1) to antiviral drugs: role of thymidine kinase in antiviral activities of substrate anal... Antimicrob Agents Chemother. 2007 Jun;51(6):2028-34.
14 3'-[4-Aryl-(1,2,3-triazol-1-yl)]-3'-deoxythymidine analogues as potent and selective inhibitors of human mitochondrial thymidine kinase. J Med Chem. 2010 Apr 8;53(7):2902-12.
15 Synthesis, in vitro, and in silico evaluation of organometallic technetium and rhenium thymidine complexes with retained substrate activity toward ... J Med Chem. 2008 Nov 13;51(21):6689-98.
16 Crystal structure of varicella zoster virus thymidine kinase. J Biol Chem. 2003 Jul 4;278(27):24680-7.