Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTP3UTW)

• DTT Name: Steroid hormone receptor ERR (ESRR)
• Synonyms: Nuclear receptor subfamily 3 group B; NR3B; ERR
• Gene Name: ESRRA
• DTT Type: Successful target; [1]
• BioChemical Class: Nuclear hormone receptor
• UniProt ID: ERR1_HUMAN ; ERR2_HUMAN ; ERR3_HUMAN
• TTD ID: T68066
• Sequence:
  MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
  PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
  CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
  LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
  SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
  GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
  EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
  MMD
• Function: Intracellular receptors (typically cytoplasmic or nuclear). Initiates signal transduction for steroid hormones which lead to changes in gene expression over a time period of hours to days
• Reactome Pathway:
  Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201)
  Nuclear Receptor transcription pathway (R-HSA-383280)
  Regulation of RUNX2 expression and activity (R-HSA-8939902)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DTT

14 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amcinonide	DMM1JL9	Exanthem		Approved	[1]
Auranofin	DMWE2N4	Inflammatory arthritis	FA2Z	Approved	[1]
Beclomethasone	DMZPHIK	Allergic rhinitis	CA08.0	Approved	[1]
Cortisone Acetate	DMG8K57	Acne vulgaris	ED80	Approved	[1]
Desonide	DMTP2NJ	Allergic rhinitis	CA08.0	Approved	[1]
Desoximetasone	DM4PXF6	Exanthem		Approved	[1]
Flumethasone Pivalate	DMU0YP6	Contact dermatitis	EK0Z	Approved	[1]
Fluocinonide	DM65KL8	Exanthem		Approved	[1]
Flurandrenolide	DMHCI9S	Exanthem		Approved	[1]
Halcinonide	DMGLAX1	Exanthem		Approved	[1]
Halobetasol Propionate	DM3GB6S	Inflammation	1A00-CA43.1	Approved	[1]
Loteprednol Etabonate	DM8QTJI	Eye inflammation	9A02	Approved	[1]
Medrysone	DMJ90O5	Corneal abrasion	NA06.4	Approved	[1]
Prednicarbate	DMBUNVW	Exanthem		Approved	[1]

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IDP-122	DM3A701	Exanthem		Phase 3	[2]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Prednisolone sodium metazoate	DM082ZW	Inflammatory bowel disease	DD72	Discontinued in Phase 2	[3]

References

• [1] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.