General Information of Drug Therapeutic Target (DTT) (ID: TTVTX4N)

DTT Name Bacterial Fatty acid synthetase I (Bact inhA)
Synonyms Enoyl-[acyl-carrier-protein] reductase [NADH]; Bacterial InhA
Gene Name Bact inhA
DTT Type
Successful target
[1]
BioChemical Class
CH-CH donor oxidoreductase
UniProt ID
INHA_MYCTU
TTD ID
T79068
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
Function Involved in the resistance against the antituberculosis drugs isoniazid and ethionamide.
BioCyc Pathway
MetaCyc:G185E-5668-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
4 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethionamide DM8K3EI Pulmonary tuberculosis 1B10.Z Approved [2]
Isoniazid DM5JVS3 Latent tuberculosis infection Approved [1]
Prothionamide DMX0EZJ Tuberculosis 1B10-1B1Z Approved [2]
Pyrazinamide DM4IF32 Meningeal tuberculosis Approved [3]
------------------------------------------------------------------------------------
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AFN-1720 DM6AJKC Bacterial infection 1A00-1C4Z Phase 2 [4]
------------------------------------------------------------------------------------
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
MMV00/0053 DMF27BS Malaria 1F40-1F45 Terminated [5]
------------------------------------------------------------------------------------
43 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(4-benzylpiperidin-1-yl)(2-fluorophenyl)methanone DMGVDEL Discovery agent N.A. Investigative [6]
(4-benzylpiperidin-1-yl)(3-chlorophenyl)methanone DMEQZ5M Discovery agent N.A. Investigative [6]
(4-benzylpiperidin-1-yl)(m-tolyl)methanone DMS16CO Discovery agent N.A. Investigative [6]
(4-benzylpiperidin-1-yl)(p-tolyl)methanone DMJ81M3 Discovery agent N.A. Investigative [7]
(4-phenylpiperazin-1-yl)(p-tolyl)methanone DM0NTA3 Discovery agent N.A. Investigative [6]
2-(2-aminophenoxy)-5-hexylphenol DMM9A8G Discovery agent N.A. Investigative [8]
2-(3-aminophenoxy)-5-hexylphenol DMC6E8R Discovery agent N.A. Investigative [8]
2-(4,6-dimethoxypyrimidin-2-yloxy)-5-hexylphenol DM1UBGQ Discovery agent N.A. Investigative [8]
2-(4-aminophenoxy)-5-hexylphenol DMP0GI8 Discovery agent N.A. Investigative [8]
2-(4-hexyl-2-methoxyphenoxy)pyrimidine DM05HBC Discovery agent N.A. Investigative [8]
2-bromo-4-methylphenyl 2-nitrobenzoate DMJ0368 Discovery agent N.A. Investigative [9]
2-Hexadecynoic acid DMTFIPZ Discovery agent N.A. Investigative [10]
2-nitro-N-(2,4,5-trichlorophenyl)benzamide DMRZK9A Discovery agent N.A. Investigative [9]
4-(2-Thienyl)-1-(4-Methylbenzyl)-1h-Imidazole DMX681M Discovery agent N.A. Investigative [11]
4-chloro-N-(2,5-dichlorophenyl)-3-nitrobenzamide DMHL9V3 Discovery agent N.A. Investigative [9]
5-hexyl-2-(2-nitrophenoxy)phenol DM0OJZF Discovery agent N.A. Investigative [8]
5-hexyl-2-(3-nitrophenoxy)phenol DM7EBQL Discovery agent N.A. Investigative [8]
5-hexyl-2-(4-nitrophenoxy)phenol DMNBLPA Discovery agent N.A. Investigative [8]
5-hexyl-2-(pyrazin-2-yloxy)phenol DM9263J Discovery agent N.A. Investigative [8]
5-hexyl-2-(pyridin-2-yloxy)phenol DMLIMOP Discovery agent N.A. Investigative [8]
5-hexyl-2-(pyridin-3-yloxy)phenol DMHZT1S Discovery agent N.A. Investigative [8]
5-hexyl-2-(pyridin-4-yloxy)phenol DMP6U3L Discovery agent N.A. Investigative [8]
5-hexyl-2-(pyrimidin-2-yloxy)phenol DMNYOV3 Discovery agent N.A. Investigative [8]
5-hexyl-2-phenoxyphenol DMHNRXT Discovery agent N.A. Investigative [8]
5-octyl-2-phenoxyphenol DMAXHEU Discovery agent N.A. Investigative [12]
5-PENTYL-2-PHENOXYPHENOL DMKHFV4 Discovery agent N.A. Investigative [7]
Beta-D-Glucose DM5IHYP Discovery agent N.A. Investigative [11]
C16-Fatty-Acyl-Substrate-Mimic DM23KNC Discovery agent N.A. Investigative [11]
Diclosan DMO3KU5 Discovery agent N.A. Investigative [11]
Genz-10850 DMB70WC Discovery agent N.A. Investigative [11]
Indole Naphthyridinone DMB4ZNW Discovery agent N.A. Investigative [11]
N-(2,4-dichlorophenyl)-2-nitrobenzamide DM5COQ9 Discovery agent N.A. Investigative [9]
N-(2,4-dichlorophenyl)-4-methyl-3-nitrobenzamide DMHJOBQ Discovery agent N.A. Investigative [9]
N-(2,4-dimethylphenyl)-2-nitrobenzamide DMFZAS9 Discovery agent N.A. Investigative [9]
N-(2,5-dichlorophenyl)-4-methoxy-3-nitrobenzamide DMUVSM1 Discovery agent N.A. Investigative [9]
N-(2-(4-hexyl-2-hydroxyphenoxy)phenyl)acetamide DM57GQN Discovery agent N.A. Investigative [8]
N-(3,5-dichlorophenyl)-2-nitrobenzamide DMDNUCL Discovery agent N.A. Investigative [9]
N-(3,5-dichlorophenyl)-4-methoxy-3-nitrobenzamide DM8DAGL Discovery agent N.A. Investigative [9]
N-(3,5-dimethoxyphenyl)-4-methyl-2-nitrobenzamide DM43QHV Discovery agent N.A. Investigative [9]
N-(3-(4-hexyl-2-hydroxyphenoxy)phenyl)acetamide DMOCZVB Discovery agent N.A. Investigative [8]
N-(4-(4-hexyl-2-hydroxyphenoxy)phenyl)acetamide DMQDI5H Discovery agent N.A. Investigative [8]
N-(4-(diethylamino)phenyl)-2-nitrobenzamide DMZAOVG Discovery agent N.A. Investigative [9]
Nicotinamide-Adenine-Dinucleotide DM9LRKB N. A. N. A. Investigative [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 43 Investigative Drug(s)

References

1 Diversity in enoyl-acyl carrier protein reductases. Cell Mol Life Sci. 2009 May;66(9):1507-17.
2 Mechanism of thioamide drug action against tuberculosis and leprosy. J Exp Med. 2007 Jan 22;204(1):73-8.
3 Pyrazinamide inhibits the eukaryotic-like fatty acid synthetase I (FASI) of Mycobacterium tuberculosis. Nat Med. 2000 Sep;6(9):1043-7.
4 Affinium Pharmaceuticals Announces the Initiation of a Phase 1 Intravenous Clinical Trial of a New Antibiotic Prodrug, and the Closing of a Follow-on Financing Round. PR Newswire Sep. 4, 2013 10:16 PM.
5 SAR and pharmacophore models for the rhodanine inhibitors of Plasmodium falciparum enoyl-acyl carrier protein reductase. IUBMB Life. 2010 Mar;62(3):204-13.
6 Inhibition of the Mycobacterium tuberculosis enoyl acyl carrier protein reductase InhA by arylamides. Bioorg Med Chem. 2007 Nov 1;15(21):6649-58.
7 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
8 Synthesis and in vitro antimycobacterial activity of B-ring modified diaryl ether InhA inhibitors. Bioorg Med Chem Lett. 2008 May 15;18(10):3029-33.
9 Discovery of potential new InhA direct inhibitors based on pharmacophore and 3D-QSAR analysis followed by in silico screening. Eur J Med Chem. 2009 Sep;44(9):3718-30.
10 2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. Bioorg Med Chem. 2010 Nov 1;18(21):7475-85.
11 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
12 Natural products, small molecules, and genetics in tuberculosis drug development. J Med Chem. 2008 May 8;51(9):2606-12.