Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWM4TY)

• DTT Name: Adrenergic receptor alpha-2B (ADRA2B)
• Synonyms: Subtype C2; Alpha-2BAR; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2B adrenergic receptor; Alpha-2 adrenergic receptor subtype C2; ADRA2RL1; ADRA2L1
• Gene Name: ADRA2B
• DTT Type: Successful target; [1]
• Related Disease: Substance abuse [ICD-11: 6C40]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: ADA2B_HUMAN
• TTD ID: T41580
• Sequence:
  MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
  VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
  NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
  FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
  ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
  EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
  AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
  LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
• Function: The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol. Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
• Reactome Pathway:
  Adrenaline signalling through Alpha-2 adrenergic receptor (R-HSA-392023)
  G alpha (i) signalling events (R-HSA-418594)
  G alpha (z) signalling events (R-HSA-418597)
  Adrenoceptors (R-HSA-390696)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MOXONIDINE	DMGFB0E	Alcohol dependence	6C40.2	Approved	[1]

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AGN-199981	DMP5Y1A	Neuropathic pain	8E43.0	Phase 2	[2]
MEDETOMIDINE	DMX9Y7V	Pain	MG30-MG3Z	Phase 2	[3]

6 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Indoramin	DMNSJFD	Hypertension	BA00-BA04	Withdrawn from market	[4]
MAZAPERTINE	DMRHYAU	N. A.	N. A.	Discontinued in Phase 2	[5]
A-80426	DMBC3DG	N. A.	N. A.	Terminated	[6]
SK&F-104078	DMRADBU	N. A.	N. A.	Terminated	[4]
SNAP-5089	DMROJEN	Heart arrhythmia	BC65	Terminated	[7]
WB-4101	DMQU8B1	N. A.	N. A.	Terminated	[8]

57 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[9]
(1,2,3,4-Tetrahydro-isoquinolin-3-yl)-methanol	DMF6WHC	Discovery agent	N.A.	Investigative	[10]
(2-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine	DME6MYZ	Discovery agent	N.A.	Investigative	[11]
(3-Ethyl-indol-1-yl)-propyl-pyridin-4-yl-amine	DM5WJBH	Discovery agent	N.A.	Investigative	[11]
(3-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine	DMHED9G	Discovery agent	N.A.	Investigative	[11]
(R)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline	DM98L2X	Discovery agent	N.A.	Investigative	[12]
(S)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline	DMS4JAG	Discovery agent	N.A.	Investigative	[12]
1',2',3',6'-Tetrahydro-[2,4']bipyridinyl	DMFDK4N	Discovery agent	N.A.	Investigative	[13]
1,2,3,4,4a,5,10,10a-Octahydro-benzo[g]quinoline	DMDYX7P	Discovery agent	N.A.	Investigative	[14]
1,2,3,4,5,6-Hexahydro-benzo[c]azocine	DMTKYFE	Discovery agent	N.A.	Investigative	[12]
1,2,3,4-Tetrahydro-benzo[h]isoquinolin-8-ol	DMHKANE	Discovery agent	N.A.	Investigative	[15]
1,2,3,4-Tetrahydro-isoquinolin-7-ol	DM5VLIE	Discovery agent	N.A.	Investigative	[15]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole	DM3JGVF	Discovery agent	N.A.	Investigative	[16]
1,2,3,4-tetrahydroisoquinoline	DMZGCEQ	Discovery agent	N.A.	Investigative	[17]
1-(3-Fluoro-pyridin-2-yl)-4-methyl-piperazine	DMWFU3T	Discovery agent	N.A.	Investigative	[13]
1-(pyridin-2-yl)piperazine	DMKE7FG	Discovery agent	N.A.	Investigative	[13]
2,3,4,5-Tetrahydro-1H-benzo[c]azepine	DM1RE9Q	Discovery agent	N.A.	Investigative	[12]
2,3,4,5-Tetrahydro-1H-benzo[e][1,4]diazepine	DM4EZOB	Discovery agent	N.A.	Investigative	[12]
2,3,4,5-Tetrahydro-benzo[f][1,4]oxazepine	DMOFG4M	Discovery agent	N.A.	Investigative	[12]
2,3-Dihydro-1H-isoindole	DMWI9XS	Discovery agent	N.A.	Investigative	[12]
2-BFi	DMFAW4R	Discovery agent	N.A.	Investigative	[18]
3-Fluoromethyl-1,2,3,4-tetrahydro-isoquinoline	DMDPUC7	Discovery agent	N.A.	Investigative	[19]
3-Methoxymethyl-1,2,3,4-tetrahydro-isoquinoline	DMH1RX6	Discovery agent	N.A.	Investigative	[10]
3-Methyl-1,2,3,4-tetrahydro-isoquinoline	DMIWQ7G	Discovery agent	N.A.	Investigative	[12]
4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole	DMFYBLH	Discovery agent	N.A.	Investigative	[3]
4-(4-Methyl-indan-1-yl)-1H-imidazole	DMYZHXR	Discovery agent	N.A.	Investigative	[20]
4-Benzo[b]thiophen-4-yl-1H-imidazole	DM02Q8N	Discovery agent	N.A.	Investigative	[21]
5-Aminomethyl-naphthalen-2-ol	DMTP9DB	Discovery agent	N.A.	Investigative	[15]
6,7,8,9-Tetrahydro-5-thia-8-aza-benzocycloheptene	DMNOI7B	Discovery agent	N.A.	Investigative	[12]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMQ1BE8	Discovery agent	N.A.	Investigative	[22]
8-Methoxy-1,2,3,4-tetrahydro-benzo[h]isoquinoline	DMY50UR	Discovery agent	N.A.	Investigative	[15]
Butyl-indol-1-yl-pyridin-4-yl-amine	DM1CX9Y	Discovery agent	N.A.	Investigative	[11]
C-(6-Methoxy-naphthalen-1-yl)-methylamine	DMJ6SYI	Discovery agent	N.A.	Investigative	[15]
C-Naphthalen-1-yl-methylamine	DMFW1JC	Discovery agent	N.A.	Investigative	[15]
Ethyl-indol-1-yl-pyridin-4-yl-amine	DM3CWFR	Discovery agent	N.A.	Investigative	[11]
GNF-PF-2857	DML5QFZ	Discovery agent	N.A.	Investigative	[23]
GNF-PF-3878	DM7BXHQ	Discovery agent	N.A.	Investigative	[23]
imiloxan	DMS4D96	Discovery agent	N.A.	Investigative	[24]
Indol-1-yl-methyl-pyridin-4-yl-amine	DMJB876	Discovery agent	N.A.	Investigative	[11]
Indol-1-yl-prop-2-ynyl-pyridin-4-yl-amine	DMR9GNW	Discovery agent	N.A.	Investigative	[11]
Indol-1-yl-pyridin-4-yl-amine	DM1F53L	Discovery agent	N.A.	Investigative	[11]
JP1302	DMMVBK6	Discovery agent	N.A.	Investigative	[23]
METHYLNORADRENALINE	DMOWMPL	Discovery agent	N.A.	Investigative	[8]
MEZILAMINE	DMVYWJS	Discovery agent	N.A.	Investigative	[25]
PIPEROXAN	DMIHO0P	Discovery agent	N.A.	Investigative	[8]
R-226161	DM4BP7S	Discovery agent	N.A.	Investigative	[26]
S-34324	DMZLQ5W	Discovery agent	N.A.	Investigative	[6]
SK&F-64139	DM60Y3Q	Discovery agent	N.A.	Investigative	[17]
SNAP-5150	DM2OLGQ	Discovery agent	N.A.	Investigative	[7]
spiroxatrine	DMPHRXQ	Discovery agent	N.A.	Investigative	[27]
TRACIZOLINE	DM18CV3	Discovery agent	N.A.	Investigative	[22]
Tramazoline	DM3ML0N	Discovery agent	N.A.	Investigative	[8]
TRYPTOLINE	DMV19K7	Discovery agent	N.A.	Investigative	[22]
xylazine	DMSXJUW	Discovery agent	N.A.	Investigative	[28]
[3H]MK-912	DMO89N0	Discovery agent	N.A.	Investigative	[27]
[3H]rauwolscine	DMBQZ2H	Discovery agent	N.A.	Investigative	[29]
[3H]RX821002	DM6IRN4	Discovery agent	N.A.	Investigative	[30], [31]

References

• [1] Synthesis and pharmacologic evaluation of 2-endo-amino-3-exo-isopropylbicyclo[2.2.1]heptane: a potent imidazoline1 receptor specific agent. J Med Chem. 1996 Mar 15;39(6):1193-5.
• [2] Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
• [3] A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic recep... J Med Chem. 1994 Jul 22;37(15):2328-33.
• [4] Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. J Med Chem. 1995 Sep 1;38(18):3415-44.
• [5] A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
• [6] Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking... J Med Chem. 2005 Mar 24;48(6):2054-71.
• [7] Design and synthesis of novel dihydropyridine alpha-1a antagonists. Bioorg Med Chem Lett. 1999 Oct 4;9(19):2843-8.
• [8] alpha 2 adrenoceptors: classification, localization, mechanisms, and targets for drugs. J Med Chem. 1982 Dec;25(12):1389-401.
• [9] Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
• [10] 3,7-Disubstituted-1,2,3,4-tetrahydroisoquinolines display remarkable potency and selectivity as inhibitors of phenylethanolamine N-methyltransferas... J Med Chem. 1999 Jun 3;42(11):1982-90.
• [11] Synthesis and structure-activity relationships of N-propyl-N-(4-pyridinyl)-1H-indol-1-amine (besipirdine) and related analogs as potential therapeu... J Med Chem. 1996 Jan 19;39(2):570-81.
• [12] Effect of ring size or an additional heteroatom on the potency and selectivity of bicyclic benzylamine-type inhibitors of phenylethanolamine N-meth... J Med Chem. 1996 Aug 30;39(18):3539-46.
• [13] Adrenoceptor and tetrabenazine antagonism activities of some pyridinyltetrahydropyridines. J Med Chem. 1984 Sep;27(9):1182-5.
• [14] N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. J Med Chem. 1998 Oct 8;41(21):4165-70.
• [15] Examination of the role of the acidic hydrogen in imparting selectivity of 7-(aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline (SK&F 29661) toward inh... J Med Chem. 1997 Dec 5;40(25):3997-4005.
• [16] Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.
• [17] Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phen... J Med Chem. 2006 Sep 7;49(18):5424-33.
• [18] Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7.
• [19] 3-hydroxymethyl-7-(N-substituted aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline inhibitors of phenylethanolamine N-methyltransferase that display re... J Med Chem. 2005 Jan 13;48(1):134-40.
• [20] Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potent... J Med Chem. 1997 Sep 12;40(19):3014-24.
• [21] alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a ... J Med Chem. 2000 Mar 9;43(5):765-8.
• [22] Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.
• [23] Structure-activity relationship of quinoline derivatives as potent and selective alpha(2C)-adrenoceptor antagonists. J Med Chem. 2006 Oct 19;49(21):6351-63.
• [24] Assessment of imiloxan as a selective alpha 2B-adrenoceptor antagonist. Br J Pharmacol. 1990 Mar;99(3):560-4.
• [25] 4-Amino-6-chloro-2-piperazinopyrimidines with selective affinity for alpha 2-adrenoceptors. J Med Chem. 1986 Aug;29(8):1394-8.
• [26] Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
• [27] The novel alpha-2 adrenergic radioligand [3H]-MK912 is alpha-2C selective among human alpha-2A, alpha-2B and alpha-2C adrenoceptors. J Pharmacol Exp Ther. 1994 Dec;271(3):1558-65.
• [28] Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol. 1998 Apr 1;55(7):1035-43.
• [29] Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol. 1992 Jul;42(1):1-5.
• [30] Further characterization of human alpha 2-adrenoceptor subtypes: [3H]RX821002 binding and definition of additional selective drugs. Eur J Pharmacol. 1994 Jan 24;252(1):43-9.
• [31] Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. J Med Chem. 1986 Oct;29(10):2000-3.