General Information of Drug Therapeutic Target (DTT) (ID: TTWM4TY)

DTT Name Adrenergic receptor alpha-2B (ADRA2B)
Synonyms Subtype C2; Alpha-2BAR; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2B adrenergic receptor; Alpha-2 adrenergic receptor subtype C2; ADRA2RL1; ADRA2L1
Gene Name ADRA2B
DTT Type
Successful target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
ADA2B_HUMAN
TTD ID
T41580
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Function
The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol. Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
KEGG Pathway
cGMP-PKG signaling pathway (hsa04022 )
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
Adrenaline signalling through Alpha-2 adrenergic receptor (R-HSA-392023 )
G alpha (i) signalling events (R-HSA-418594 )
G alpha (z) signalling events (R-HSA-418597 )
Adrenoceptors (R-HSA-390696 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
MOXONIDINE DMGFB0E Alcohol dependence 6C40.2 Approved [1]
------------------------------------------------------------------------------------
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AGN-199981 DMP5Y1A Neuropathic pain 8E43.0 Phase 2 [2]
MEDETOMIDINE DMX9Y7V Pain MG30-MG3Z Phase 2 [3]
------------------------------------------------------------------------------------
6 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
INDORAMIN DMNSJFD Hypertension BA00-BA04 Withdrawn from market [4]
MAZAPERTINE DMRHYAU N. A. N. A. Discontinued in Phase 2 [5]
A-80426 DMBC3DG N. A. N. A. Terminated [6]
SK&F-104078 DMRADBU N. A. N. A. Terminated [4]
SNAP-5089 DMROJEN Heart arrhythmia BC65 Terminated [7]
WB-4101 DMQU8B1 N. A. N. A. Terminated [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Discontinued Drug(s)
57 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+/-)-nantenine DM0L3GE Discovery agent N.A. Investigative [9]
(1,2,3,4-Tetrahydro-isoquinolin-3-yl)-methanol DMF6WHC Discovery agent N.A. Investigative [10]
(2-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine DME6MYZ Discovery agent N.A. Investigative [11]
(3-Ethyl-indol-1-yl)-propyl-pyridin-4-yl-amine DM5WJBH Discovery agent N.A. Investigative [11]
(3-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine DMHED9G Discovery agent N.A. Investigative [11]
(R)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline DM98L2X Discovery agent N.A. Investigative [12]
(S)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline DMS4JAG Discovery agent N.A. Investigative [12]
1',2',3',6'-Tetrahydro-[2,4']bipyridinyl DMFDK4N Discovery agent N.A. Investigative [13]
1,2,3,4,4a,5,10,10a-Octahydro-benzo[g]quinoline DMDYX7P Discovery agent N.A. Investigative [14]
1,2,3,4,5,6-Hexahydro-benzo[c]azocine DMTKYFE Discovery agent N.A. Investigative [12]
1,2,3,4-Tetrahydro-benzo[h]isoquinolin-8-ol DMHKANE Discovery agent N.A. Investigative [15]
1,2,3,4-Tetrahydro-isoquinolin-7-ol DM5VLIE Discovery agent N.A. Investigative [15]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole DM3JGVF Discovery agent N.A. Investigative [16]
1,2,3,4-tetrahydroisoquinoline DMZGCEQ Discovery agent N.A. Investigative [17]
1-(3-Fluoro-pyridin-2-yl)-4-methyl-piperazine DMWFU3T Discovery agent N.A. Investigative [13]
1-(pyridin-2-yl)piperazine DMKE7FG Discovery agent N.A. Investigative [13]
2,3,4,5-Tetrahydro-1H-benzo[c]azepine DM1RE9Q Discovery agent N.A. Investigative [12]
2,3,4,5-Tetrahydro-1H-benzo[e][1,4]diazepine DM4EZOB Discovery agent N.A. Investigative [12]
2,3,4,5-Tetrahydro-benzo[f][1,4]oxazepine DMOFG4M Discovery agent N.A. Investigative [12]
2,3-Dihydro-1H-isoindole DMWI9XS Discovery agent N.A. Investigative [12]
2-BFi DMFAW4R Discovery agent N.A. Investigative [18]
3-Fluoromethyl-1,2,3,4-tetrahydro-isoquinoline DMDPUC7 Discovery agent N.A. Investigative [19]
3-Methoxymethyl-1,2,3,4-tetrahydro-isoquinoline DMH1RX6 Discovery agent N.A. Investigative [10]
3-Methyl-1,2,3,4-tetrahydro-isoquinoline DMIWQ7G Discovery agent N.A. Investigative [12]
4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole DMFYBLH Discovery agent N.A. Investigative [3]
4-(4-Methyl-indan-1-yl)-1H-imidazole DMYZHXR Discovery agent N.A. Investigative [20]
4-Benzo[b]thiophen-4-yl-1H-imidazole DM02Q8N Discovery agent N.A. Investigative [21]
5-Aminomethyl-naphthalen-2-ol DMTP9DB Discovery agent N.A. Investigative [15]
6,7,8,9-Tetrahydro-5-thia-8-aza-benzocycloheptene DMNOI7B Discovery agent N.A. Investigative [12]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline DMQ1BE8 Discovery agent N.A. Investigative [22]
8-Methoxy-1,2,3,4-tetrahydro-benzo[h]isoquinoline DMY50UR Discovery agent N.A. Investigative [15]
Butyl-indol-1-yl-pyridin-4-yl-amine DM1CX9Y Discovery agent N.A. Investigative [11]
C-(6-Methoxy-naphthalen-1-yl)-methylamine DMJ6SYI Discovery agent N.A. Investigative [15]
C-Naphthalen-1-yl-methylamine DMFW1JC Discovery agent N.A. Investigative [15]
Ethyl-indol-1-yl-pyridin-4-yl-amine DM3CWFR Discovery agent N.A. Investigative [11]
GNF-PF-2857 DML5QFZ Discovery agent N.A. Investigative [23]
GNF-PF-3878 DM7BXHQ Discovery agent N.A. Investigative [23]
imiloxan DMS4D96 Discovery agent N.A. Investigative [24]
Indol-1-yl-methyl-pyridin-4-yl-amine DMJB876 Discovery agent N.A. Investigative [11]
Indol-1-yl-prop-2-ynyl-pyridin-4-yl-amine DMR9GNW Discovery agent N.A. Investigative [11]
Indol-1-yl-pyridin-4-yl-amine DM1F53L Discovery agent N.A. Investigative [11]
JP1302 DMMVBK6 Discovery agent N.A. Investigative [23]
METHYLNORADRENALINE DMOWMPL Discovery agent N.A. Investigative [8]
MEZILAMINE DMVYWJS Discovery agent N.A. Investigative [25]
PIPEROXAN DMIHO0P Discovery agent N.A. Investigative [8]
R-226161 DM4BP7S Discovery agent N.A. Investigative [26]
S-34324 DMZLQ5W Discovery agent N.A. Investigative [6]
SK&F-64139 DM60Y3Q Discovery agent N.A. Investigative [17]
SNAP-5150 DM2OLGQ Discovery agent N.A. Investigative [7]
spiroxatrine DMPHRXQ Discovery agent N.A. Investigative [27]
TRACIZOLINE DM18CV3 Discovery agent N.A. Investigative [22]
Tramazoline DM3ML0N Discovery agent N.A. Investigative [8]
TRYPTOLINE DMV19K7 Discovery agent N.A. Investigative [22]
xylazine DMSXJUW Discovery agent N.A. Investigative [28]
[3H]MK-912 DMO89N0 Discovery agent N.A. Investigative [27]
[3H]rauwolscine DMBQZ2H Discovery agent N.A. Investigative [29]
[3H]RX821002 DM6IRN4 Discovery agent N.A. Investigative [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 57 Investigative Drug(s)

References

1 Synthesis and pharmacologic evaluation of 2-endo-amino-3-exo-isopropylbicyclo[2.2.1]heptane: a potent imidazoline1 receptor specific agent. J Med Chem. 1996 Mar 15;39(6):1193-5.
2 Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
3 A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic recep... J Med Chem. 1994 Jul 22;37(15):2328-33.
4 Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. J Med Chem. 1995 Sep 1;38(18):3415-44.
5 A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
6 Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking... J Med Chem. 2005 Mar 24;48(6):2054-71.
7 Design and synthesis of novel dihydropyridine alpha-1a antagonists. Bioorg Med Chem Lett. 1999 Oct 4;9(19):2843-8.
8 alpha 2 adrenoceptors: classification, localization, mechanisms, and targets for drugs. J Med Chem. 1982 Dec;25(12):1389-401.
9 Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
10 3,7-Disubstituted-1,2,3,4-tetrahydroisoquinolines display remarkable potency and selectivity as inhibitors of phenylethanolamine N-methyltransferas... J Med Chem. 1999 Jun 3;42(11):1982-90.
11 Synthesis and structure-activity relationships of N-propyl-N-(4-pyridinyl)-1H-indol-1-amine (besipirdine) and related analogs as potential therapeu... J Med Chem. 1996 Jan 19;39(2):570-81.
12 Effect of ring size or an additional heteroatom on the potency and selectivity of bicyclic benzylamine-type inhibitors of phenylethanolamine N-meth... J Med Chem. 1996 Aug 30;39(18):3539-46.
13 Adrenoceptor and tetrabenazine antagonism activities of some pyridinyltetrahydropyridines. J Med Chem. 1984 Sep;27(9):1182-5.
14 N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. J Med Chem. 1998 Oct 8;41(21):4165-70.
15 Examination of the role of the acidic hydrogen in imparting selectivity of 7-(aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline (SK&F 29661) toward inh... J Med Chem. 1997 Dec 5;40(25):3997-4005.
16 Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.
17 Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phen... J Med Chem. 2006 Sep 7;49(18):5424-33.
18 Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7.
19 3-hydroxymethyl-7-(N-substituted aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline inhibitors of phenylethanolamine N-methyltransferase that display re... J Med Chem. 2005 Jan 13;48(1):134-40.
20 Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potent... J Med Chem. 1997 Sep 12;40(19):3014-24.
21 alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a ... J Med Chem. 2000 Mar 9;43(5):765-8.
22 Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.
23 Structure-activity relationship of quinoline derivatives as potent and selective alpha(2C)-adrenoceptor antagonists. J Med Chem. 2006 Oct 19;49(21):6351-63.
24 Assessment of imiloxan as a selective alpha 2B-adrenoceptor antagonist. Br J Pharmacol. 1990 Mar;99(3):560-4.
25 4-Amino-6-chloro-2-piperazinopyrimidines with selective affinity for alpha 2-adrenoceptors. J Med Chem. 1986 Aug;29(8):1394-8.
26 Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
27 The novel alpha-2 adrenergic radioligand [3H]-MK912 is alpha-2C selective among human alpha-2A, alpha-2B and alpha-2C adrenoceptors. J Pharmacol Exp Ther. 1994 Dec;271(3):1558-65.
28 Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol. 1998 Apr 1;55(7):1035-43.
29 Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol. 1992 Jul;42(1):1-5.
30 Further characterization of human alpha 2-adrenoceptor subtypes: [3H]RX821002 binding and definition of additional selective drugs. Eur J Pharmacol. 1994 Jan 24;252(1):43-9.