Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXMY0J)

• DTT Name: Pancreatic triacylglycerol lipase (PNLIP)
• Synonyms: Pancreatic lipase; PTL; PL
• Gene Name: PNLIP
• DTT Type: Successful target; [1]
• BioChemical Class: Carboxylic ester hydrolase
• UniProt ID: LIPP_HUMAN
• TTD ID: T94309
• EC Number: EC 3.1.1.3
• Sequence:
  MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
  ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
  VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
  RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
  LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
  PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
  VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
  NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
• Function: Catalyses the following chemical reaction: triacylglycerol + H2O diacylglycerol + a carboxylate. Acts only on an ester-water interface.
• KEGG Pathway:
  Glycerolipid metabolism (hsa00561)
  Metabolic pathways (hsa01100)
  Pancreatic secretion (hsa04972)
  Fat digestion and absorption (hsa04975)
  Vitamin digestion and absorption (hsa04977)
• Reactome Pathway: Retinoid metabolism and transport (R-HSA-975634)
• BioCyc Pathway: MetaCyc:HS10947-MON

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dalbavancin	DMGMNH3	Bacterial infection	1A00-1C4Z	Approved	[1]
Orlistat	DMRJSP8	Obesity	5B81	Approved	[2]

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Pancrecarb	DMOML9Q	Pancreatic malfunction	DC30-DC3Z	NDA filed	[3]
Liprotamase	DMNF4UH	Cystic fibrosis	CA25	Phase 3	[4]
MS-1819	DM35YFC	Exocrine pancreatic insufficiency	DC35.1	Phase 1/2	[5]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AZM-131	DMLCSRF	Obesity	5B81	Terminated	[6]

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(Hydroxyethyloxy)Tri(Ethyloxy)Octane	DMY6FUD	Discovery agent	N.A.	Investigative	[7]
B-Nonylglucoside	DM48VJR	Discovery agent	N.A.	Investigative	[8]
B-Octylglucoside	DMMO75G	Discovery agent	N.A.	Investigative	[7]
Daio-Orengedokuto (DOT)	DM3M652	Discovery agent	N.A.	Investigative	[9]
METHOXYUNDECYLPHOSPHINIC ACID	DMY0O7X	Discovery agent	N.A.	Investigative	[8]

References

• [1] Pfizer. Product Development Pipeline. March 31 2009.
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [3] Clinical pipeline report, company report or official report of Digestive Care.
• [4] Clinical pipeline report, company report or official report of Anthera Pharmaceuticals.
• [5] Clinical pipeline report, company report or official report of AzurRx.
• [6] US patent application no. 7217,697, Glucopyranosyloxypyrazole derivative medicinal composition containing the same medicinal use thereof and intermediate therefor.
• [7] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [8] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [9] Daio-Orengedokuto inhibits HMG-CoA reductase and pancreatic lipase. Biol Pharm Bull. 2002 Nov;25(11):1442-5.