Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZFYLI)

• DTT Name: Dopamine D1 receptor (D1R)
• Synonyms: D(1A) dopamine receptor
• Gene Name: DRD1
• DTT Type: Successful target; [1]
• Related Disease:
  Abortion [ICD-11: JA00]
  Allergic/hypersensitivity disorder [ICD-11: 4A80-4A8Z]
  Hypertension [ICD-11: BA00-BA04]
  Parkinsonism [ICD-11: 8A00]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: DRD1_HUMAN
• TTD ID: T22118
• Sequence:
  MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
  FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
  RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
  ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
  CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
  GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
  VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
  SVILDYDTDVSLEKIQPITQNGQHPT
• Function: Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  cAMP signaling pathway (hsa04024)
  Neuroactive ligand-receptor interaction (hsa04080)
  Gap junction (hsa04540)
  Dopaminergic synapse (hsa04728)
  Parkinson's disease (hsa05012)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Morphine addiction (hsa05032)
  Alcoholism (hsa05034)
• Reactome Pathway:
  G alpha (s) signalling events (R-HSA-418555)
  Dopamine receptors (R-HSA-390651)

Molecular Interaction Atlas (MIA) of This DTT

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Fenoldopam	DMFAOKP	Hypertension	BA00-BA04	Approved	[1]
Methylergonovine	DMBEX4O	Spontaneous abortion	JA00.0	Approved	[2]
Pergolide	DM14MAE	Parkinson disease	8A00.0	Approved	[3]
Phenyltoloxamine	DMKAEQW	Allergy	4A80-4A85	Approved	[4]

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ecopipam	DMS9R43	Cocaine addiction	6C45.2	Phase 3	[5]
Zicronapine	DMP8ESD	Schizophrenia	6A20	Phase 3	[6]
DAS-431	DMM3BPL	Dementia	6D80-6D86	Phase 2	[7]
Dihydrexidine	DMACPQO	Psychotic disorder	6A20-6A25	Phase 1/2	[8]

19 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ADROGOLIDE HYDROCHLORIDE	DMS8JIU	Cognitive impairment	6D71	Discontinued in Phase 2	[7], [9]
ADX-10061	DMZS2M4	Psychotic disorder	6A20-6A25	Discontinued in Phase 2	[10]
BAM-1110	DMPMKUF	Parkinson disease	8A00.0	Discontinued in Phase 2	[11]
CY-208243	DMP8TKA	Pain	MG30-MG3Z	Discontinued in Phase 2	[12], [13]
ZELANDOPAM HYDROCHLORIDE	DM1QXPE	Hypertension	BA00-BA04	Discontinued in Phase 2	[14], [9]
Berupipam	DMU1YON	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[15]
BTS-73947	DMGVEJ6	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[16], [9]
Odapipam	DMZN6F3	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[17]
SDZ-GLC-756	DM1C0K4	Glaucoma/ocular hypertension	9C61	Discontinued in Phase 1	[18]
A 77636	DM0NY6K	Parkinson disease	8A00.0	Terminated	[20]
A-68930	DMUJ94B	Hypertension	BA00-BA04	Terminated	[21], [22]
A-69024	DMPL1OV	Psychotic disorder	6A20-6A25	Terminated	[23]
BIMG80	DM9X1DZ	Psychotic disorder	6A20-6A25	Terminated	[24]
CEE-03-320	DMGEFX7	Substance use disorder	6C4Z	Terminated	[25]
NNC-22-0031	DMK7BV9	Psychotic disorder	6A20-6A25	Terminated	[26]
Org-10490	DMUGC2X	Psychotic disorder	6A20-6A25	Terminated	[3]
SDZ-PSD-958	DM48MCL	Psychiatric disorder	6E8Z	Terminated	[27]
SKF 38393	DMIMJ8Z	Type-2 diabetes	5A11	Terminated	[28]
SKF-81297	DM4LGPT	Parkinson disease	8A00.0	Terminated	[29]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BSF-78438	DMO15TX	Schizophrenia	6A20	Preclinical	[19]

84 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+)-(1R,1'S)-berbamunine hydrochloride	DMF62GN	Discovery agent	N.A.	Investigative	[30]
(+)-(1R,1'S)-thaligrisine hydrochloride	DM521S4	Discovery agent	N.A.	Investigative	[30]
(+)-ADTN	DMXWCVY	Discovery agent	N.A.	Investigative	[31]
(+)-BUTACLAMOL	DMX6UYN	Discovery agent	N.A.	Investigative	[32]
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[33]
(-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride	DM974LP	Discovery agent	N.A.	Investigative	[30]
(R)-(+)-coclaurine	DM7C148	Discovery agent	N.A.	Investigative	[34]
(R)-(-)-10-methyl-11-hydroxyaporphine	DMYJAM5	Discovery agent	N.A.	Investigative	[35]
(R)-(-)-11-hydroxy-N-n-propylnoraporphine	DMKB621	Discovery agent	N.A.	Investigative	[36]
(R)-(-)-2-methoxy-11-hydroxyaporphine	DMQ2INJ	Discovery agent	N.A.	Investigative	[36]
(R)-(-)-2-methoxy-N-npropylnorapomorphine	DMLXB62	Discovery agent	N.A.	Investigative	[36]
(R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine	DMPSEZV	Discovery agent	N.A.	Investigative	[36]
(R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine	DM48SML	Discovery agent	N.A.	Investigative	[36]
(R)-11-Amino-2-methoxyaporphine	DMKJWMC	Discovery agent	N.A.	Investigative	[37]
(R)-2,11-Diaminoaporphine	DM70ZIF	Discovery agent	N.A.	Investigative	[37]
(R,S)-homoaromaline hydrochloride	DMUG451	Discovery agent	N.A.	Investigative	[30]
(S)-BULBOCAPNINE	DMPI0AX	Discovery agent	N.A.	Investigative	[38]
(S)APOMORPHINE	DMEKGIX	Discovery agent	N.A.	Investigative	[39]
(S,S)-oxandrine hydrochloride	DMYDS6F	Discovery agent	N.A.	Investigative	[30]
1,2,3,7,12,12a-hexahydro-1-aza-pleiaden-5-ol	DMYDGAZ	Discovery agent	N.A.	Investigative	[38]
1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol	DMAJ0B4	Discovery agent	N.A.	Investigative	[38]
1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane	DM9ENXO	Discovery agent	N.A.	Investigative	[40]
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine	DMUDVRM	Discovery agent	N.A.	Investigative	[41]
1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol	DMBWNL6	Discovery agent	N.A.	Investigative	[42]
1-Aminomethyl-3-phenyl-isochroman-5,6-diol	DMJNG8A	Discovery agent	N.A.	Investigative	[22]
1-Aminomethyl-isochroman-5,6-diol	DM50GS7	Discovery agent	N.A.	Investigative	[22]
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine	DMF0GXD	Discovery agent	N.A.	Investigative	[43]
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine	DMBRJ5S	Discovery agent	N.A.	Investigative	[43]
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine	DMSBNY8	Discovery agent	N.A.	Investigative	[43]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine	DMOL2Y0	Discovery agent	N.A.	Investigative	[44]
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine	DMTNRG7	Discovery agent	N.A.	Investigative	[4]
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine	DMLSU30	Discovery agent	N.A.	Investigative	[4]
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine	DMD2NXL	Discovery agent	N.A.	Investigative	[4]
11-Butyryloxy-N-n-propylnoraporphine	DMH5QEA	Discovery agent	N.A.	Investigative	[45]
11-Heptanoyloxy-N-n-propylnoraporphine	DMX4I9D	Discovery agent	N.A.	Investigative	[45]
11-Hexanoyloxy-N-n-propylnoraporphine	DMRYV9E	Discovery agent	N.A.	Investigative	[45]
11-Propionyloxy-N-n-propylnoraporphine	DM62FEH	Discovery agent	N.A.	Investigative	[45]
11-valeryloxynoraporphine	DMM91WE	Discovery agent	N.A.	Investigative	[45]
2-methoxyapomorphine	DMPG0V7	Discovery agent	N.A.	Investigative	[40]
2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline	DMY65CX	Discovery agent	N.A.	Investigative	[46]
2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol	DM9TCWA	Discovery agent	N.A.	Investigative	[40]
3,8-dibromoboldine	DM23CEI	Discovery agent	N.A.	Investigative	[47]
3-bromoboldine	DMPF7O2	Discovery agent	N.A.	Investigative	[47]
3-Chloroboldine	DM5J1TX	Discovery agent	N.A.	Investigative	[47]
3-Iodoboldine	DM890WJ	Discovery agent	N.A.	Investigative	[47]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[48]
4-[2-(2-Benzyl-phenoxy)-ethyl]-morpholine	DM08CG7	Discovery agent	N.A.	Investigative	[4]
5-(2-Amino-ethyl)-2-chloro-phenol hydrobromide	DMJXI65	Discovery agent	N.A.	Investigative	[49]
6-(2-Amino-ethyl)-biphenyl-2,3,4'-triol	DMO724D	Discovery agent	N.A.	Investigative	[50]
6-(2-Amino-ethyl)-biphenyl-2,3-diol	DMI8KOF	Discovery agent	N.A.	Investigative	[50]
6-(2-Dipropylamino-ethyl)-biphenyl-2,3,4'-triol	DM3VME7	Discovery agent	N.A.	Investigative	[50]
6-(2-Dipropylamino-ethyl)-biphenyl-2,3-diol	DMNQWZO	Discovery agent	N.A.	Investigative	[50]
9-Aminomethyl-9H-fluorene-2,5,6-triol	DM9123M	Discovery agent	N.A.	Investigative	[50]
9-Aminomethyl-9H-fluorene-3,4-diol	DMNG6O7	Discovery agent	N.A.	Investigative	[50]
BOLDINE	DMMVB5P	Discovery agent	N.A.	Investigative	[47]
Etoloxamine	DMDOX1Z	Discovery agent	N.A.	Investigative	[4]
FALCARINDIOL	DMLOV18	Discovery agent	N.A.	Investigative	[51]
FLUMEZAPINE	DMW0HOG	Discovery agent	N.A.	Investigative	[52]
FLUTROLINE	DMUOHVL	Discovery agent	N.A.	Investigative	[53]
GLAUCINE	DMSP7V8	Discovery agent	N.A.	Investigative	[38]
IBZM	DMUSRJ8	Discovery agent	N.A.	Investigative	[54]
ISOCLOZAPINE	DM52CPU	Discovery agent	N.A.	Investigative	[55]
ISOLOXAPINE	DMH1BN4	Discovery agent	N.A.	Investigative	[56]
MCL-516	DMQA7ZI	Discovery agent	N.A.	Investigative	[57]
MELOSMINE	DM3492O	Discovery agent	N.A.	Investigative	[38]
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide	DMU1ATH	Discovery agent	N.A.	Investigative	[58]
N-(4-Propylaminobutyl)-4-biphenylcarboxamide	DMG9D7A	Discovery agent	N.A.	Investigative	[58]
N-propylnorapomorphine	DMO7MTX	N. A.	N. A.	Investigative	[31]
NORSTEPHALAGINE	DM1VIHC	Discovery agent	N.A.	Investigative	[38]
PUKATEINE	DM4SGVF	Discovery agent	N.A.	Investigative	[38]
QUINPIROLE	DMDNHEP	Discovery agent	N.A.	Investigative	[59]
Ro-21-7767	DMOE0JX	Discovery agent	N.A.	Investigative	[60]
SB-271046	DM5VJAF	Discovery agent	N.A.	Investigative	[61]
SCH-12679	DMP8OKA	Discovery agent	N.A.	Investigative	[62]
SCH-23390	DMT1OAH	N. A.	N. A.	Investigative	[63]
SCH-24518	DM6SC5K	Discovery agent	N.A.	Investigative	[64]
SK&F-89626	DM3SUKX	Discovery agent	N.A.	Investigative	[65]
SKF-75670	DMQ6YXF	Discovery agent	N.A.	Investigative	[66]
SKF-83556	DMCMQH8	Discovery agent	N.A.	Investigative	[31]
SKF-83959	DMWC6RU	Discovery agent	N.A.	Investigative	[67]
STEPHOLIDINE	DMGMXQC	Discovery agent	N.A.	Investigative	[68]
TEPA (possesses cytotoxic activity)	DMROS5K	Discovery agent	N.A.	Investigative	[69]
[125I]SCH23982	DM06S9X	Discovery agent	N.A.	Investigative	[70]
[R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether	DM8YF3V	Discovery agent	N.A.	Investigative	[40]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Schizophrenia	6A20	Pre-frontal cortex	2.79E-02	-0.53	-0.53
Schizophrenia	6A20	Superior temporal cortex	4.77E-01	0.1	0.26
Parkinson's disease	8A00.0	Substantia nigra tissue	8.99E-01	-0.06	-0.3
Type 2 diabetes	5A11	Liver tissue	3.08E-01	-0.02	-0.14

References

• [1] Etiology of iodinated radiocontrast nephrotoxicity and its attenuation by beraprost. Yakugaku Zasshi. 2008 Jul;128(7):1023-9.
• [2] Reinforcement in an in vitro analog of appetitive classical conditioning of feeding behavior in Aplysia: blockade by a dopamine antagonist. Learn Mem. 2005 May-Jun;12(3):216-20.
• [3] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [4] Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8.
• [5] A D1 receptor antagonist, ecopipam, for treatment of tics in Tourette syndrome.Clin Neuropharmacol.2014 Jan-Feb;37(1):26-30.
• [6] Clinical pipeline report, company report or official report of Lundbeck.
• [7] Adrogolide HCl (ABT-431; DAS-431), a prodrug of the dopamine D1 receptor agonist, A-86929: preclinical pharmacology and clinical data. CNS Drug Rev. 2001 Fall;7(3):305-16.
• [8] trans-2,3-dihydroxy-6a,7,8,12b-tetrahydro-6H-chromeno[3,4-c]isoquinoline: synthesis, resolution, and preliminary pharmacological characterization o... J Med Chem. 2006 Nov 16;49(23):6848-57.
• [9] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [10] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476)
• [11] Therapeutic effects of dopamine D1/D2 receptor agonists on detrusor hyperreflexia in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-lesioned parkinso... J Pharmacol Exp Ther. 1998 Jul;286(1):228-33.
• [12] The D-1 dopamine receptor partial agonist, CY 208-243, exhibits antiparkinsonian activity in the MPTP-treated marmoset. Eur J Pharmacol. 1988 Nov 1;156(2):197-206.
• [13] Dopamine D1 receptor agonists induce penile erections in rats. Eur J Pharmacol. 2003 Jan 26;460(1):71-4.
• [14] Effect of zelandopam, a dopamine D1-like receptor agonist, in puromycin aminonucleoside nephrosis rats. Eur J Pharmacol. 2005 Mar 7;510(1-2):121-6.
• [15] Characterization of benzazepine UDP-glucuronosyl-transferases in laboratory animals and man. Xenobiotica. 1995 Jun;25(6):611-22.
• [16] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043)
• [17] PET studies of binding competition between endogenous dopamine and the D1 radiotracer [11C]NNC 756. Synapse. 1999 May;32(2):93-109.
• [18] SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30.
• [19] The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
• [20] Actions of the D1 agonists A-77636 and A-86929 on locomotion and dyskinesia in MPTP-treated L-dopa-primed common marmosets. Psychopharmacology (Berl). 1999 Feb;142(1):51-60.
• [21] Comparison of the D1-dopamine agonists SKF-38393 and A-68930 in neonatal 6-hydroxydopamine-lesioned rats: behavioral effects and induction of c-fos-like immunoreactivity. J Pharmacol Exp Ther. 1992 Aug;262(2):855-65.
• [22] (1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. J Med Chem. 1990 Nov;33(11):2948-50.
• [23] (+)-[76Br]A-69024: a non-benzazepine radioligand for studies of dopamine D1 receptors using PET. Nucl Med Biol. 2002 Apr;29(3):295-302.
• [24] BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90.
• [25] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189)
• [26] NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78.
• [27] SDZ PSD 958, a novel D1 receptor antagonist with potential limbic selectivity. J Neural Transm. 1996;103(3):261-76.
• [28] The D1 dopamine receptor agonist SKF-38393 stimulates the release of glutamate in the hippocampus. Neuroscience. 1999;94(4):1063-70.
• [29] Dopamine D1 receptor involvement in the discriminative-stimulus effects of SKF 81297 in squirrel monkeys. J Pharmacol Exp Ther. 1993 Nov;267(2):765-75.
• [30] Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6.
• [31] Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9.
• [32] 7-Methyl-6,7,8,9,14,15-hexahydro-5H-benz[d]indolo[2,3-g]azecine: a new heterocyclic system and a new lead compound for dopamine receptor antagonists. J Med Chem. 2000 May 18;43(10):2079-81.
• [33] Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
• [34] Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. J Nat Prod. 1998 Jun 26;61(6):709-12.
• [35] R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30.
• [36] Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selec... J Med Chem. 2008 Feb 28;51(4):983-7.
• [37] Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. Bioorg Med Chem. 2008 Jul 15;16(14):6675-81.
• [38] Advances in development of dopaminergic aporphinoids. J Med Chem. 2007 Jan 25;50(2):171-81.
• [39] Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. J Med Chem. 1990 Jun;33(6):1800-5.
• [40] Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. Bioorg Med Chem. 2008 Apr 15;16(8):4563-8.
• [41] Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9.
• [42] Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. J Med Chem. 1991 Oct;34(10):2946-53.
• [43] Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.
• [44] Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8.
• [45] N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands. Bioorg Med Chem. 2008 Sep 15;16(18):8335-8.
• [46] Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. J Med Chem. 1981 Sep;24(9):1107-10.
• [47] Halogenated boldine derivatives with enhanced monoamine receptor selectivity. J Nat Prod. 2000 Apr;63(4):480-4.
• [48] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [49] Synthesis and pharmacological characterization of 2-(4-chloro-3-hydroxyphenyl)ethylamine and N,N-dialkyl derivatives as dopamine receptor ligands. J Med Chem. 1992 Nov 13;35(23):4408-14.
• [50] Synthesis and dopaminergic binding of 2-aryldopamine analogues: phenethylamines, 3-benzazepines, and 9-(aminomethyl)fluorenes. J Med Chem. 1986 Oct;29(10):1904-12.
• [51] Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23.
• [52] Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. J Med Chem. 1982 Oct;25(10):1133-40.
• [53] Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43.
• [54] In vitro affinities of various halogenated benzamide derivatives as potential radioligands for non-invasive quantification of D(2)-like dopamine re... Bioorg Med Chem. 2007 Nov 1;15(21):6819-29.
• [55] Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53.
• [56] Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6.
• [57] Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3.
• [58] Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. J Med Chem. 2008 Nov 13;51(21):6829-38.
• [59] Pharmacophore-guided drug discovery investigations leading to bioactive 5-aminotetrahydropyrazolopyridines. Implications for the binding mode of he... J Med Chem. 2005 Sep 8;48(18):5771-9.
• [60] Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine recepto... J Med Chem. 1995 Jan 20;38(2):318-27.
• [61] Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43.
• [62] Modified ibogaine fragments: synthesis and preliminary pharmacological characterization of 3-ethyl-5-phenyl-1,2,3,4,5, 6-hexahydroazepino[4,5-b]ben... J Med Chem. 1998 Nov 5;41(23):4486-91.
• [63] Dopamine modulates effort-based decision making in rats. Behav Neurosci. 2009 Apr;123(2):242-51.
• [64] Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. J Med Chem. 1988 Oct;31(10):1941-6.
• [65] trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. J Med Chem. 1990 Jun;33(6):1756-64.
• [66] Dopamine receptor agonists: selectivity and dopamine D1 receptor efficacy. Eur J Pharmacol. 1990 Jun 12;188(6):335-47.
• [67] Identification of G protein-biased agonists that fail to recruit beta-arrestin or promote internalization of the D1 dopamine receptor. ACS Chem Neurosci. 2015 Apr 15;6(4):681-92.
• [68] Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907.
• [69] N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. J Med Chem. 1998 Oct 8;41(21):4165-70.
• [70] Molecular cloning and expression of the gene for a human D1 dopamine receptor. Nature. 1990 Sep 6;347(6288):72-6.