General Information of Drug Therapeutic Target (DTT) (ID: TTZHY6R)

DTT Name Glycogen phosphorylase muscle form (GP)
Synonyms Muscle glycogen phosphorylase; Glycogen phosphorylase, muscle form; Glycogen phosphorylase b
Gene Name PYGM
DTT Type
Patented-recorded target
[1]
Related Disease
Metabolic disorder [ICD-11: 5C50-5D2Z]
BioChemical Class
Glycosyltransferases
UniProt ID
PYGM_HUMAN
TTD ID
T98062
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 2.4.1.1
Sequence
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERM
DWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFV
PRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
KLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYED
YIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
AI
Function
Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Phosphorylase is an important allosteric enzyme in carbohydrate metabolism.
KEGG Pathway
Starch and sucrose metabolism (hsa00500 )
Metabolic pathways (hsa01100 )
Insulin signaling pathway (hsa04910 )
Glucagon signaling pathway (hsa04922 )
Reactome Pathway
Glycogen breakdown (glycogenolysis) (R-HSA-70221 )
BioCyc Pathway
MetaCyc:HS00949-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
URSOLIC ACID DM4SOAW Metabolic syndrome x 5C50-5D2Z Phase 2 [2]
------------------------------------------------------------------------------------
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
JTT-651 DMGP42Q Type-2 diabetes 5A11 Discontinued in Phase 1 [1]
------------------------------------------------------------------------------------
41 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1-D-glucopyranosyl cytosine DM4NBUH Discovery agent N.A. Investigative [3]
1-D-glucopyranosyl uracil DM90ULM Discovery agent N.A. Investigative [3]
1-Deoxy-1-Methoxycarbamido-Beta-D-Glucopyranose DMOEQDP Discovery agent N.A. Investigative [4]
1-N-Acetyl-Beta-D-Glucosamine DMF87Z5 Discovery agent N.A. Investigative [4]
2-Deoxy-Glucose-6-Phosphate DMMPL3D Discovery agent N.A. Investigative [4]
2-Hydroxyiminoolean-12-en-28-oic acid DMNXV2I Discovery agent N.A. Investigative [2]
2-Hydroxyiminours-12-en-28-oic acid DMDKF03 Discovery agent N.A. Investigative [2]
2-isooleanolic acid DMOVRX7 Discovery agent N.A. Investigative [2]
2-isoursolic acid DMEZFKS Discovery agent N.A. Investigative [2]
2-Oxoolean-12-en-28-oic acid DMDMK81 Discovery agent N.A. Investigative [2]
23-hydroxybetulinic acid DM27GH0 Discovery agent N.A. Investigative [5]
2alpha-Hydroxyolean-12-en-28-oic acid DMHY2RA Discovery agent N.A. Investigative [2]
2alpha-Hydroxyurs-12-en-28-oic acid DM1RSCP Discovery agent N.A. Investigative [2]
2beta,3alpha-dihydroxyolean-12-en-28-oic acid DMV4OY2 Discovery agent N.A. Investigative [6]
2beta,3alpha-dihydroxyurs-12-en-28-oic acid DMU4Q8C Discovery agent N.A. Investigative [6]
3alpha-Hydroxyurs-12-en-28-oic Acid DMV6OPB Discovery agent N.A. Investigative [5]
4-{2-[(3-Nitrobenzoyl)Amino]Phenoxy}Phthalic Acid DMMGHNA Discovery agent N.A. Investigative [7]
Acurea DMMQKCV Discovery agent N.A. Investigative [8]
Alpha-D-Glucopyranosyl-2-Carboxylic Acid Amide DMD2TPA Discovery agent N.A. Investigative [4]
Alpha-D-Glucose-1-Phosphate DMU36HT Discovery agent N.A. Investigative [4]
Alpha-D-Glucose-6-Phosphate DMR0EVN Discovery agent N.A. Investigative [4]
ASIATIC ACID DMT8Y65 Discovery agent N.A. Investigative [5]
Benzyl 2-hydroxyiminoolean-12-en-28-oate DMT3JYE Discovery agent N.A. Investigative [2]
Beta-D-Glucopyranose Spirohydantoin DMZ2BR9 Discovery agent N.A. Investigative [4]
Beta-D-Glucose DM5IHYP Discovery agent N.A. Investigative [4]
BETULIN DMGQRON Discovery agent N.A. Investigative [5]
C-(1-Azido-Alpha-D-Glucopyranosyl) Formamide DMMPXHQ Discovery agent N.A. Investigative [9]
C-(1-Hydrogyl-Beta-D-Glucopyranosyl) Formamide DM3VF9M Discovery agent N.A. Investigative [4]
Ethyl 2beta-hydroxyolean-12-en-28-oate DMPUCMV Discovery agent N.A. Investigative [2]
Fluoro-Phosphite Ion DMIRBYE Discovery agent N.A. Investigative [4]
Heptulose-2-Phosphate DMIAQX4 Discovery agent N.A. Investigative [4]
Indirubin-5-sulfonate DM08VHZ Discovery agent N.A. Investigative [4]
Inosinic Acid DMLR86H Discovery agent N.A. Investigative [4]
L-serine-O-phosphate DMTJ1NH Discovery agent N.A. Investigative [4]
N'-Pyridoxyl-Lysine-5'-Monophosphate DM3ZHBO Discovery agent N.A. Investigative [4]
N-Acetyl-N'-Beta-D-Glucopyranosyl Urea DMUNCFQ Discovery agent N.A. Investigative [9]
N-Benzoyl-N'-Beta-D-Glucopyranosyl Urea DM7U81L Discovery agent N.A. Investigative [4]
N-Butyl 2beta-hydroxyolean-12-en-28-oate DMAQT6S Discovery agent N.A. Investigative [2]
Nojirimycine Tetrazole DMYZRTB Discovery agent N.A. Investigative [7]
OLEANOLIC_ACID DMWDMJ3 Discovery agent N.A. Investigative [5]
Oleanonic acid DMYPJC3 Discovery agent N.A. Investigative [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Type 2 diabetes 5A11 Liver tissue 2.69E-01 -0.23 -0.14
------------------------------------------------------------------------------------

References

1 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026877)
2 Synthesis of 3-deoxypentacyclic triterpene derivatives as inhibitors of glycogen phosphorylase. J Nat Prod. 2009 Aug;72(8):1414-8.
3 1-(3-Deoxy-3-fluoro-beta-d-glucopyranosyl) pyrimidine derivatives as inhibitors of glycogen phosphorylase b: Kinetic, crystallographic and modellin... Bioorg Med Chem. 2010 May 15;18(10):3413-25.
4 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
5 Naturally occurring pentacyclic triterpenes as inhibitors of glycogen phosphorylase: synthesis, structure-activity relationships, and X-ray crystal... J Med Chem. 2008 Jun 26;51(12):3540-54.
6 Practical synthesis of bredemolic acid, a natural inhibitor of glycogen phosphorylase. J Nat Prod. 2008 Nov;71(11):1877-80.
7 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
8 Binding of N-acetyl-N '-beta-D-glucopyranosyl urea and N-benzoyl-N '-beta-D-glucopyranosyl urea to glycogen phosphorylase b: kinetic and crystallographic studies. Eur J Biochem. 2002 Mar;269(6):1684-96.
9 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.