Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3GT9C)
DME Name | Cytochrome P450 4F2 (CYP4F2) | ||||
---|---|---|---|---|---|
Synonyms |
Cytochrome P450 family 4 subfamily F member 2; Arachidonic acid omega-hydroxylase; CYP4F2; CYPIVF2; Leukotriene-B(4) 20-monooxygenase 1; Leukotriene-B(4) omega-hydroxylase 1; Phylloquinone omega-hydroxylase CYP4F2
|
||||
Gene Name | CYP4F2 | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 1.14.13.30 | ||||
Lineage |
Species: Homo sapiens |
||||
Sequence |
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF
WGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK DKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL LASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEIL LHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE LLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKV VLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS |
||||
Function |
This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, eicosanoids and vitamins. It catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of long- and very long-chain fatty acids and displays high omega-hydroxylase activity toward polyunsaturated fatty acids (PUFAs). It participates in the conversion of arachidonic acid to omega-hydroxyeicosatetraenoic acid (20-HETE) and plays a role in the oxidative inactivation of eicosanoids. In addition, it catalyzes omega-hydroxylation of 3-hydroxy fatty acids and converts monoepoxides of linoleic acid leukotoxin and isoleukotoxin to omega-hydroxylated metabolites. It also contributes to the degradation of very long-chain fatty acids (VLCFAs) by catalyzing successive omega-oxidations and chain shortening. It plays an important role in vitamin metabolism by chain shortening and catalyzes omega- hydroxylation of the phytyl chain of tocopherols (forms of vitamin E), with preference for gamma-tocopherols over alpha-tocopherols. It also can Omega-hydroxylates and inactivates phylloquinone (vitamin K1), and menaquinone-4 (MK-4, a form of vitamin K2), both acting as cofactors in blood coagulation.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||
3 Clinical Trial Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||
1 Investigative Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DME
References
1 | Cloning and characterization of CYP4F21: a prostaglandin E2 20-hydroxylase of ram seminal vesicles. Arch Biochem Biophys. 2001 May 1;389(1):123-9. | ||||
---|---|---|---|---|---|
2 | CYP4F enzymes are responsible for the elimination of fingolimod (FTY720), a novel treatment of relapsing multiple sclerosis. Drug Metab Dispos. 2011 Feb;39(2):191-8. | ||||
3 | cDNA cloning and expression of a novel cytochrome p450 (cyp4f12) from human small intestine. Biochem Biophys Res Commun. 2001 Feb 2;280(4):1135-41. | ||||
4 | Human enteric microsomal CYP4F enzymes O-demethylate the antiparasitic prodrug pafuramidine. Drug Metab Dispos. 2007 Nov;35(11):2067-75. | ||||
5 | Discovery, characterization, and significance of the cytochrome P450 omega-hydroxylase pathway of vitamin E catabolism. Ann N Y Acad Sci. 2004 Dec;1031:13-21. | ||||
6 | Product information - Gilenya. | ||||
7 | Role of cytochrome P450 enzymes in the bioactivation of polyunsaturated fatty acids. Biochim Biophys Acta. 2011 Jan;1814(1):210-22. | ||||