Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEWU03P)

DME Name Sorbitol dehydrogenase (SORD)
Synonyms Ribitol dehydrogenase; Xylitol dehydrogenase; Polyol dehydrogenase; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; RDH; SDH; SORD
Gene Name SORD
UniProt ID
DHSO_HUMAN
INTEDE ID
DME0578
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6652
EC Number EC: 1.1.1.14
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.14
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNF
IVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFC
ATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCG
AGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL
GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRY
CNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Function
This enzyme catalyzes the reversible NAD(+)- dependent oxidation of various sugar alcohols. It is mostly active with D- sorbitol (D-glucitol), L-threitol, xylitol and ribitol as substrates, leading to the C2-oxidized products D-fructose, L-erythrulose, D- xylulose, and D-ribulose, respectively. It is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. It also catalyzes the stereospecific oxidation of (2R,3R)-2,3-butanediol. And to a lesser extent, it can also oxidize L-arabinitol, galactitol and D-mannitol and glycerol in vitro.
KEGG Pathway
Fructose and mannose metabolism (hsa00051 )
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Reactome Pathway
Fructose biosynthesis (R-HSA-5652227 )
Formation of xylulose-5-phosphate (R-HSA-5661270 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fructose DM43AN2 Vomiting MD90 Approved [3]
Sorbitol DMAN0DE Constipation DD91.1 Approved [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.51E-34 6.05E-01 1.53E+00
Alopecia ED70 Skin from scalp 1.02E-06 6.27E-01 1.25E+00
Alzheimer's disease 8A20 Entorhinal cortex 6.64E-01 -1.72E-02 -5.56E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 6.75E-02 3.51E-01 1.23E+00
Aortic stenosis BB70 Calcified aortic valve 9.95E-01 -9.07E-02 -1.44E-01
Apnea 7A40 Hyperplastic tonsil 6.41E-01 3.68E-01 1.50E+00
Arthropathy FA00-FA5Z Peripheral blood 1.17E-01 1.06E-01 5.02E-01
Asthma CA23 Nasal and bronchial airway 3.36E-01 2.48E-01 1.98E-01
Atopic dermatitis EA80 Skin 6.23E-02 -3.95E-01 -5.02E-01
Autism 6A02 Whole blood 3.41E-01 -1.35E-02 -5.95E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.96E-01 1.49E-01 6.62E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.37E-02 -3.81E-01 -7.20E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.41E-10 -3.70E-01 -9.69E-01
Batten disease 5C56.1 Whole blood 8.66E-01 -2.34E-02 -1.46E-01
Behcet's disease 4A62 Peripheral blood 3.76E-01 2.42E-02 1.18E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.58E-01 1.17E-01 4.98E-01
Bladder cancer 2C94 Bladder tissue 3.68E-01 2.06E-01 5.03E-01
Breast cancer 2C60-2C6Z Breast tissue 3.00E-55 9.34E-01 1.26E+00
Cardioembolic stroke 8B11.20 Whole blood 7.68E-04 -3.24E-01 -9.69E-01
Cervical cancer 2C77 Cervical tissue 4.32E-01 -8.14E-02 -1.47E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.97E-01 1.65E-01 1.90E-01
Chronic hepatitis C 1E51.1 Whole blood 9.42E-01 -2.54E-02 -4.33E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 7.37E-01 3.49E-02 1.54E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.52E-01 -1.02E-01 -1.44E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.52E-01 1.01E+00 1.13E+00
Colon cancer 2B90 Colon tissue 5.13E-100 1.24E+00 3.27E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.65E-02 2.09E-01 2.45E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.40E-01 1.25E-01 3.14E-01
Endometriosis GA10 Endometrium tissue 5.36E-05 -1.12E+00 -1.14E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.74E-01 1.04E-01 4.30E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.68E-01 -3.57E-02 -1.68E-01
Gastric cancer 2B72 Gastric tissue 1.05E-01 4.32E-01 2.00E+00
Glioblastopma 2A00.00 Nervous tissue 6.08E-18 1.23E-01 2.95E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.22E-01 -1.18E-02 -1.53E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.50E-03 3.58E-01 9.48E-01
Head and neck cancer 2D42 Head and neck tissue 4.99E-05 -1.72E-01 -2.21E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.07E-01 -1.67E-02 -7.91E-02
Huntington's disease 8A01.10 Whole blood 5.87E-01 -7.00E-02 -2.98E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.92E-03 4.99E-01 1.66E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.92E-02 -2.43E-01 -1.66E+00
Influenza 1E30 Whole blood 1.02E-01 6.35E-01 2.36E+00
Interstitial cystitis GC00.3 Bladder tissue 1.62E-04 -1.19E+00 -3.64E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.79E-01 -4.86E-02 -1.09E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.57E-01 -5.02E-03 -1.46E-02
Ischemic stroke 8B11 Peripheral blood 3.92E-01 3.46E-02 1.79E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.07E-02 -2.66E-04 -4.60E-04
Lateral sclerosis 8B60.4 Skin 3.05E-02 2.62E-01 1.37E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.62E-01 -1.08E-01 -1.64E-01
Liver cancer 2C12.0 Liver tissue 6.45E-10 -9.99E-01 -1.35E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.74E-03 -1.84E+00 -3.02E+00
Lung cancer 2C25 Lung tissue 4.42E-88 9.82E-01 2.26E+00
Lupus erythematosus 4A40 Whole blood 1.56E-03 -1.36E-01 -3.58E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.81E-02 5.68E-02 2.39E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.93E-01 1.07E-01 3.58E-01
Melanoma 2C30 Skin 4.49E-02 -9.76E-01 -9.07E-01
Multiple myeloma 2A83.1 Peripheral blood 7.96E-01 -3.65E-01 -9.57E-01
Multiple myeloma 2A83.1 Bone marrow 4.59E-03 5.81E-01 1.71E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.59E-02 -3.37E-01 -1.03E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.28E-03 1.07E-01 2.63E-01
Myelofibrosis 2A20.2 Whole blood 5.58E-01 -1.32E-02 -7.06E-02
Myocardial infarction BA41-BA50 Peripheral blood 2.84E-01 -1.56E-01 -2.39E-01
Myopathy 8C70.6 Muscle tissue 9.63E-01 -6.97E-02 -2.20E-01
Neonatal sepsis KA60 Whole blood 8.42E-02 -7.07E-02 -2.09E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.11E-01 -9.35E-02 -2.70E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.56E-01 8.53E-02 1.44E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.37E-01 -2.10E-01 -1.38E+00
Olive pollen allergy CA08.00 Peripheral blood 7.75E-01 1.91E-01 2.62E-01
Oral cancer 2B6E Oral tissue 1.49E-01 3.98E-01 6.33E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.10E-01 3.90E-01 6.78E-01
Osteoporosis FB83.1 Bone marrow 7.33E-02 2.38E-01 1.28E+00
Ovarian cancer 2C73 Ovarian tissue 7.21E-03 1.18E+00 1.48E+00
Pancreatic cancer 2C10 Pancreas 2.98E-03 3.00E-01 6.34E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.62E-01 8.00E-02 3.05E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.55E-03 1.67E-01 7.48E-01
Pituitary cancer 2D12 Pituitary tissue 2.52E-01 1.68E-02 3.25E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.17E-01 -6.62E-02 -1.21E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.86E-01 7.26E-02 3.03E-01
Polycythemia vera 2A20.4 Whole blood 1.15E-06 -1.52E-01 -7.70E-01
Pompe disease 5C51.3 Biceps muscle 1.48E-02 5.07E-01 1.62E+00
Preterm birth KA21.4Z Myometrium 8.11E-01 -1.44E-01 -5.94E-01
Prostate cancer 2C82 Prostate 9.01E-01 -3.94E-02 -2.65E-02
Psoriasis EA90 Skin 4.45E-01 -3.03E-02 -5.24E-02
Rectal cancer 2B92 Rectal colon tissue 1.43E-04 9.62E-01 3.11E+00
Renal cancer 2C90-2C91 Kidney 4.25E-03 -1.31E+00 -1.17E+00
Retinoblastoma 2D02.2 Uvea 2.72E-13 2.30E+00 1.09E+01
Rheumatoid arthritis FA20 Synovial tissue 1.34E-04 7.39E-01 3.04E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.15E-01 1.51E-02 3.71E-02
Schizophrenia 6A20 Prefrontal cortex 2.82E-01 -7.24E-02 -2.08E-01
Schizophrenia 6A20 Superior temporal cortex 2.35E-01 -3.78E-03 -2.42E-02
Scleroderma 4A42.Z Whole blood 9.25E-01 5.07E-02 2.45E-01
Seizure 8A60-8A6Z Whole blood 9.14E-02 -2.59E-02 -1.21E-01
Sensitive skin EK0Z Skin 1.78E-01 -3.14E-01 -1.40E+00
Sepsis with septic shock 1G41 Whole blood 7.67E-05 -8.96E-02 -2.60E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.82E-02 -1.80E-01 -7.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.41E-02 6.21E-01 1.17E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.19E-01 -1.67E-01 -6.09E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.28E-01 -8.63E-02 -1.04E+00
Skin cancer 2C30-2C3Z Skin 7.89E-11 -3.98E-01 -5.44E-01
Thrombocythemia 3B63 Whole blood 1.58E-05 -1.87E-01 -9.28E-01
Thrombocytopenia 3B64 Whole blood 9.19E-02 -3.96E-01 -6.26E-01
Thyroid cancer 2D10 Thyroid 9.38E-45 -1.77E+00 -2.54E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.60E-01 -4.59E-02 -1.83E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.37E-01 -1.68E-02 -9.40E-02
Type 2 diabetes 5A11 Liver tissue 8.34E-01 -4.19E-02 -9.07E-02
Ureter cancer 2C92 Urothelium 8.78E-01 3.78E-01 3.73E-01
Uterine cancer 2C78 Endometrium tissue 4.60E-04 -4.39E-01 -4.14E-01
Vitiligo ED63.0 Skin 7.27E-01 -2.26E-01 -4.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Sorbitoldehydrogenase (SORD) DTT Info
DME DTT Type Literature-reported
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CP-470,711 DMS2RHE Discovery agent N.A. Investigative [1]
Nicotinamide-Adenine-Dinucleotide DM9LRKB N. A. N. A. Investigative [2]

References

1 Sorbitol dehydrogenase: a novel target for adjunctive protection of ischemic myocardium. FASEB J. 2003 Dec;17(15):2331-3.
2 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
3 Isolation, characterization and evaluation of the Pichia pastoris sorbitol dehydrogenase promoter for expression of heterologous proteins. Protein Expr Purif. 2013 Nov;92(1):128-33.
4 Plasma concentration of iditol dehydrogenase (sorbitol dehydrogenase) in ponies treated with aflatoxin B1. Am J Vet Res. 1980 Jun;41(6):925-7.