Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0F3HCQ)

DOT Name Tetratricopeptide repeat protein 23 (TTC23)
Synonyms TPR repeat protein 23; Cervical cancer proto-oncogene 8 protein; HCC-8
Gene Name TTC23
Related Disease
Hepatocellular carcinoma ( )
UniProt ID
TTC23_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13424
Sequence
MQESQETHISNHLDEVVAAVSITHRKKFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHE
YKQAVHELVRCVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKARQILAN
SIVPPYSENTDVFKFSIELFHTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEE
WIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSRECVPILRELAGVEQA
LGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAVASGRHEHHDVAEQYFQESMA
HLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYR
LLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQA
SKAKVAFCTSIPQDTLLGKARPGTTAD
Function Participates positively in the ciliary Hedgehog (Hh) signaling.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 moderate Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Tetratricopeptide repeat protein 23 (TTC23). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [6]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Tetratricopeptide repeat protein 23 (TTC23). [7]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Tetratricopeptide repeat protein 23 (TTC23). [7]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [11]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Tetratricopeptide repeat protein 23 (TTC23). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Tetratricopeptide repeat protein 23 (TTC23). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Tetratricopeptide repeat protein 23 (TTC23). [9]
------------------------------------------------------------------------------------

References

1 Plasma DNA methylation marker and hepatocellular carcinoma risk prediction model for the general population.Carcinogenesis. 2017 Oct 1;38(10):1021-1028. doi: 10.1093/carcin/bgx078.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
12 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.