General Information of Drug Off-Target (DOT) (ID: OT0Q04QD)

DOT Name Protein AMN1 homolog (AMN1)
Gene Name AMN1
UniProt ID
AMN1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13516
Sequence
MPRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILH
PEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEA
SLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVS
DSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREV
LEQLVGPNKLKQVTWTVY

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Protein AMN1 homolog (AMN1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein AMN1 homolog (AMN1). [2]
Quercetin DM3NC4M Approved Quercetin increases the expression of Protein AMN1 homolog (AMN1). [3]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Protein AMN1 homolog (AMN1). [4]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of Protein AMN1 homolog (AMN1). [5]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Protein AMN1 homolog (AMN1). [6]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Protein AMN1 homolog (AMN1). [8]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Protein AMN1 homolog (AMN1). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein AMN1 homolog (AMN1). [10]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Protein AMN1 homolog (AMN1). [11]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Protein AMN1 homolog (AMN1). [12]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Protein AMN1 homolog (AMN1). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Protein AMN1 homolog (AMN1). [7]
------------------------------------------------------------------------------------

References

1 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
6 The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
9 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
10 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
11 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
12 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
13 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.