Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT18YR25)

• DOT Name: Protein eva-1 homolog C (EVA1C)
• Synonyms: Protein FAM176C; SUE21
• Gene Name: EVA1C
• Related Disease:
  Adenocarcinoma
  Polyp
  Hemoglobinopathy
• UniProt ID: EVA1C_HUMAN
• Pfam ID: PF14851 ; PF02140
• Sequence:
  MLLPGRARQPPTPQPVQHPGLRRQVEPPGQLLRLFYCTVLVCSKEISALTDFSGYLTKLL
  QNHTTYACDGDYLNLQCPRHSTISVQSAFYGQDYQMCSSQKPASQREDSLTCVAATTFQK
  VLDECQNQRACHLLVNSRVFGPDLCPGSSKYLLVSFKCQPNELKNKTVCEDQELKLHCHE
  SKFLNIYSATYGRRTQERDICSSKAERLPPFDCLSYSALQVLSRRCYGKQRCKIIVNNHH
  FGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLKQKDGEYGINFDPSGSKVLRK
  DGILVSNSLAAFAYIRAHPERAALLFVSSVCIGLALTLCALVIRESCAKDFRDLQLGREQ
  LVPGSDKVEEDSEDEEEEEDPSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQII
  QEIWMNSGLDTSLPRNMGQFY
• Function: Binds heparin.
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	moderate	Biomarker	[1]
Polyp	DISRSLYF	moderate	Biomarker	[1]
Hemoglobinopathy	DISCT4GX	Limited	Biomarker	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein eva-1 homolog C (EVA1C).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Protein eva-1 homolog C (EVA1C).	[11]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein eva-1 homolog C (EVA1C).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein eva-1 homolog C (EVA1C).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Protein eva-1 homolog C (EVA1C).	[6]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein eva-1 homolog C (EVA1C).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Protein eva-1 homolog C (EVA1C).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein eva-1 homolog C (EVA1C).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein eva-1 homolog C (EVA1C).	[10]

References

• [1] Detection of parvovirus B19 nucleic acids and expression of viral VP1/VP2 antigen in human colon carcinoma.Am J Gastroenterol. 2007 Jul;102(7):1489-98. doi: 10.1111/j.1572-0241.2007.01240.x. Epub 2007 Apr 24.
• [2] Persistent B19 infection in immunocompetent individuals: implications for transfusion safety.Blood. 2005 Oct 15;106(8):2890-5. doi: 10.1182/blood-2005-03-1053. Epub 2005 Jun 23.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [8] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [9] Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
• [10] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.