Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT25XOGF)

• DOT Name: Lymphocyte antigen 6K (LY6K)
• Synonyms: Ly-6K
• Gene Name: LY6K
• UniProt ID: LY6K_HUMAN
• Pfam ID: PF00021
• Sequence:
  MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
  KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY
  CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS
• Function: Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida. May play a role in cell growth.
• Tissue Specificity: Specifically expressed in testis (at protein level).
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Lymphocyte antigen 6K (LY6K).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Lymphocyte antigen 6K (LY6K).	[6]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Lymphocyte antigen 6K (LY6K).	[2]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Lymphocyte antigen 6K (LY6K).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Lymphocyte antigen 6K (LY6K).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Lymphocyte antigen 6K (LY6K).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Lymphocyte antigen 6K (LY6K).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Lymphocyte antigen 6K (LY6K).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Lymphocyte antigen 6K (LY6K).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Lymphocyte antigen 6K (LY6K).	[10]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of Lymphocyte antigen 6K (LY6K).	[11]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [3] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [4] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [5] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [8] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [11] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.