General Information of Drug Off-Target (DOT) (ID: OT2AMYLY)

DOT Name Phospholipid scramblase 4 (PLSCR4)
Synonyms PL scramblase 4; Ca(2+)-dependent phospholipid scramblase 4; Cell growth-inhibiting gene 43 protein; TRA1
Gene Name PLSCR4
Related Disease
Cardiac failure ( )
Choroid plexus carcinoma ( )
Congestive heart failure ( )
Non-small-cell lung cancer ( )
Plasma cell myeloma ( )
Teratoma ( )
Adult lymphoma ( )
Lymphoma ( )
Pediatric lymphoma ( )
Small-cell lung cancer ( )
Follicular lymphoma ( )
UniProt ID
PLS4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3Q5U
Pfam ID
PF03803
Sequence
MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGY
YSPQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLD
NIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTD
CMGREIMTMQRPFRCTCCCFCCPSARQELEVQCPPGVTIGFVAEHWNLCRAVYSIQNEKK
ENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWNGLLSAMADADHFDIHFPLDL
DVKMKAMIFGACFLIDFMYFERSPPQRSR
Function
May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Tissue Specificity Expressed in heart, brain, placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, uterus, small intestine and colon. Not detected in peripheral blood lymphocytes.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiac failure DISDC067 Strong Biomarker [1]
Choroid plexus carcinoma DISQ04MQ Strong Biomarker [2]
Congestive heart failure DIS32MEA Strong Biomarker [1]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [3]
Plasma cell myeloma DIS0DFZ0 Strong Altered Expression [4]
Teratoma DIS6ICY4 Strong Altered Expression [5]
Adult lymphoma DISK8IZR moderate Genetic Variation [6]
Lymphoma DISN6V4S moderate Genetic Variation [6]
Pediatric lymphoma DIS51BK2 moderate Genetic Variation [6]
Small-cell lung cancer DISK3LZD moderate Biomarker [7]
Follicular lymphoma DISVEUR6 Disputed Biomarker [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Phospholipid scramblase 4 (PLSCR4). [9]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Phospholipid scramblase 4 (PLSCR4). [10]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Phospholipid scramblase 4 (PLSCR4). [11]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Phospholipid scramblase 4 (PLSCR4). [12]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Phospholipid scramblase 4 (PLSCR4). [13]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Phospholipid scramblase 4 (PLSCR4). [14]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Phospholipid scramblase 4 (PLSCR4). [15]
Dasatinib DMJV2EK Approved Dasatinib increases the expression of Phospholipid scramblase 4 (PLSCR4). [16]
Beta-carotene DM0RXBT Approved Beta-carotene increases the expression of Phospholipid scramblase 4 (PLSCR4). [17]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Phospholipid scramblase 4 (PLSCR4). [18]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Phospholipid scramblase 4 (PLSCR4). [20]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Phospholipid scramblase 4 (PLSCR4). [21]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Phospholipid scramblase 4 (PLSCR4). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Phospholipid scramblase 4 (PLSCR4). [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Phospholipid scramblase 4 (PLSCR4). [22]
------------------------------------------------------------------------------------

References

1 The lncRNA Plscr4 Controls Cardiac Hypertrophy by Regulating miR-214.Mol Ther Nucleic Acids. 2018 Mar 2;10:387-397. doi: 10.1016/j.omtn.2017.12.018. Epub 2017 Dec 30.
2 DNA methylation signature is prognostic of choroid plexus tumor aggressiveness.Clin Epigenetics. 2019 Aug 13;11(1):117. doi: 10.1186/s13148-019-0708-z.
3 Long non-coding RNA LINC00641 suppresses non-small-cell lung cancer by sponging miR-424-5p to upregulate PLSCR4.Cancer Biomark. 2019;26(1):79-91. doi: 10.3233/CBM-190142.
4 A molecular compendium of genes expressed in multiple myeloma.Blood. 2002 Sep 15;100(6):2175-86. doi: 10.1182/blood-2002-01-0008.
5 Differentiation of spontaneously contracting cardiomyocytes from non-virally reprogrammed human amniotic fluid stem cells.PLoS One. 2017 May 17;12(5):e0177824. doi: 10.1371/journal.pone.0177824. eCollection 2017.
6 The common viral insertion site Evi12 is located in the 5'-noncoding region of Gnn, a novel gene with enhanced expression in two subclasses of human acute myeloid leukemia.J Virol. 2005 May;79(9):5249-58. doi: 10.1128/JVI.79.9.5249-5258.2005.
7 Comprehensive genomic analysis identifies SOX2 as a frequently amplified gene in small-cell lung cancer.Nat Genet. 2012 Oct;44(10):1111-6. doi: 10.1038/ng.2405. Epub 2012 Sep 2.
8 Identification of TRA-1-60-positive cells as a potent refractory population in follicular lymphomas.Cancer Sci. 2019 Jan;110(1):443-457. doi: 10.1111/cas.13870. Epub 2018 Dec 8.
9 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
10 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
11 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
12 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
13 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
14 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
15 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
16 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
17 Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
18 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
19 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
20 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
21 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
22 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
23 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.