General Information of Drug Off-Target (DOT) (ID: OT2DVJWY)

DOT Name Fibroblast growth factor 19 (FGF19)
Synonyms FGF-19
Gene Name FGF19
UniProt ID
FGF19_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1PWA; 2P23; 6KTR; 6NFJ
Pfam ID
PF00167
Sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Function
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Tissue Specificity Expressed in fetal brain, cartilage, retina, and adult gall bladder.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Ras sig.ling pathway (hsa04014 )
Rap1 sig.ling pathway (hsa04015 )
Calcium sig.ling pathway (hsa04020 )
PI3K-Akt sig.ling pathway (hsa04151 )
Regulation of actin cytoskeleton (hsa04810 )
Pathways in cancer (hsa05200 )
Melanoma (hsa05218 )
Breast cancer (hsa05224 )
Gastric cancer (hsa05226 )
Reactome Pathway
(FGFR4 )
PIP3 activates AKT signaling (R-HSA-1257604 )
betaKlotho-mediated ligand binding (R-HSA-1307965 )
FGFR4 ligand binding and activation (R-HSA-190322 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Phospholipase C-mediated cascade (R-HSA-5654228 )
FRS-mediated FGFR4 signaling (R-HSA-5654712 )
SHC-mediated cascade (R-HSA-5654719 )
PI-3K cascade (R-HSA-5654720 )
Negative regulation of FGFR4 signaling (R-HSA-5654733 )
RAF/MAP kinase cascade (R-HSA-5673001 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
PI3K Cascade (R-HSA-109704 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Fibroblast growth factor 19 (FGF19). [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Fibroblast growth factor 19 (FGF19). [2]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of Fibroblast growth factor 19 (FGF19). [3]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Fibroblast growth factor 19 (FGF19). [4]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Fibroblast growth factor 19 (FGF19). [5]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Fibroblast growth factor 19 (FGF19). [6]
Obeticholic acid DM3Q1SM Approved Obeticholic acid increases the expression of Fibroblast growth factor 19 (FGF19). [7]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Fibroblast growth factor 19 (FGF19). [8]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid increases the expression of Fibroblast growth factor 19 (FGF19). [9]
Ritonavir DMU764S Approved Ritonavir increases the expression of Fibroblast growth factor 19 (FGF19). [10]
Chenodiol DMQ8JIK Approved Chenodiol increases the expression of Fibroblast growth factor 19 (FGF19). [11]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the expression of Fibroblast growth factor 19 (FGF19). [9]
Clavulanate DM2FGRT Approved Clavulanate increases the expression of Fibroblast growth factor 19 (FGF19). [13]
Cholic acid DM7OKQV Approved Cholic acid increases the expression of Fibroblast growth factor 19 (FGF19). [9]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Fibroblast growth factor 19 (FGF19). [5]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Fibroblast growth factor 19 (FGF19). [15]
DM9CEI5 increases the expression of Fibroblast growth factor 19 (FGF19). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ardeparin DMYRX8B Approved Ardeparin affects the binding of Fibroblast growth factor 19 (FGF19). [12]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Fibroblast growth factor 19 (FGF19). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Fibroblast growth factor 19 (FGF19). [16]
------------------------------------------------------------------------------------

References

1 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2 Combination of retinoic acid and ursodeoxycholic acid attenuates liver injury in bile duct-ligated rats and human hepatic cells. Hepatology. 2011 Feb;53(2):548-57. doi: 10.1002/hep.24047. Epub 2010 Dec 10.
3 Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
4 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
5 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
7 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
8 Lithocholic acid induction of the FGF19 promoter in intestinal cells is mediated by PXR. World J Gastroenterol. 2007 Aug 21;13(31):4230-5. doi: 10.3748/wjg.v13.i31.4230.
9 Potency of individual bile acids to regulate bile acid synthesis and transport genes in primary human hepatocyte cultures. Toxicol Sci. 2014 Oct;141(2):538-46. doi: 10.1093/toxsci/kfu151. Epub 2014 Jul 23.
10 Transcriptional profiling suggests that Nevirapine and Ritonavir cause drug induced liver injury through distinct mechanisms in primary human hepatocytes. Chem Biol Interact. 2016 Aug 5;255:31-44.
11 A role for FXR and human FGF-19 in the repression of paraoxonase-1 gene expression by bile acids. J Lipid Res. 2006 Feb;47(2):384-92.
12 The crystal structure of fibroblast growth factor (FGF) 19 reveals novel features of the FGF family and offers a structural basis for its unusual receptor affinity. Biochemistry. 2004 Jan 27;43(3):629-40. doi: 10.1021/bi035320k.
13 Molecular mechanisms of hepatotoxic cholestasis by clavulanic acid: Role of NRF2 and FXR pathways. Food Chem Toxicol. 2021 Dec;158:112664. doi: 10.1016/j.fct.2021.112664. Epub 2021 Nov 9.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
16 Bisphenol A Represses Dopaminergic Neuron Differentiation from Human Embryonic Stem Cells through Downregulating the Expression of Insulin-like Growth Factor 1. Mol Neurobiol. 2017 Jul;54(5):3798-3812. doi: 10.1007/s12035-016-9898-y. Epub 2016 Jun 7.