Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2HDZFD)

• DOT Name: Probable RNA-binding protein 18 (RBM18)
• Synonyms: RNA-binding motif protein 18
• Gene Name: RBM18
• UniProt ID: RBM18_HUMAN
• Pfam ID: PF00076
• Sequence:
  MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHK
  SGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKIL
  PISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTP
  YSRTAWKSRR

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Probable RNA-binding protein 18 (RBM18).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Probable RNA-binding protein 18 (RBM18).	[9]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Probable RNA-binding protein 18 (RBM18).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Probable RNA-binding protein 18 (RBM18).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Probable RNA-binding protein 18 (RBM18).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Probable RNA-binding protein 18 (RBM18).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Probable RNA-binding protein 18 (RBM18).	[6]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Probable RNA-binding protein 18 (RBM18).	[7]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Probable RNA-binding protein 18 (RBM18).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Probable RNA-binding protein 18 (RBM18).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Probable RNA-binding protein 18 (RBM18).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.