Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2N9SAW)

• DOT Name: Stannin (SNN)
• Synonyms: AG8_1
• Gene Name: SNN
• UniProt ID: SNN_HUMAN
• PDB ID: 1ZZA
• Pfam ID: PF09051 ; PF09050 ; PF09049
• Sequence:
  MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPF
  LLVQYSAKGPCVERKAKLMTPNGPEVHG
• Function: Plays a role in the toxic effects of organotins. Plays a role in endosomal maturation.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Stannin (SNN).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Stannin (SNN).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Stannin (SNN).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Stannin (SNN).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Stannin (SNN).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Stannin (SNN).	[1]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Stannin (SNN).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Stannin (SNN).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Stannin (SNN).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Stannin (SNN).	[7]

References

• [1] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [9] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.