Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2UVSD2)

DOT Name Kelch-like protein 23 (KLHL23)
Gene Name KLHL23
Related Disease
Bipolar disorder ( )
Major depressive disorder ( )
Schizophrenia ( )
UniProt ID
KLH23_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07707 ; PF00651 ; PF01344
Sequence
MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSN
YFKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITKRNVQSLLEAADLLQFL
SVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISL
EKFLFILSRKNLSVWKEEAIIEPVIKWTAHDVENRIECLYNLLSYINIDIDPVYLKTALG
LQRSCLLTENKIRSLIYNALNPMHKEISQRSTATMYIIGGYYWHPLSEVHIWDPLTNVWI
QGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWTEGLPMLNARY
YHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITEC
YDPEQNEWREIAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIV
GNLPSAMRSHGCVCVYNV

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bipolar disorder DISAM7J2 Strong Genetic Variation [1]
Major depressive disorder DIS4CL3X Strong Genetic Variation [1]
Schizophrenia DISSRV2N Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Kelch-like protein 23 (KLHL23). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Kelch-like protein 23 (KLHL23). [13]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Kelch-like protein 23 (KLHL23). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Kelch-like protein 23 (KLHL23). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Kelch-like protein 23 (KLHL23). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Kelch-like protein 23 (KLHL23). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Kelch-like protein 23 (KLHL23). [7]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Kelch-like protein 23 (KLHL23). [8]
Progesterone DMUY35B Approved Progesterone increases the expression of Kelch-like protein 23 (KLHL23). [9]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Kelch-like protein 23 (KLHL23). [10]
Rifampicin DM5DSFZ Approved Rifampicin decreases the expression of Kelch-like protein 23 (KLHL23). [11]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Kelch-like protein 23 (KLHL23). [12]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Kelch-like protein 23 (KLHL23). [14]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Kelch-like protein 23 (KLHL23). [10]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Kelch-like protein 23 (KLHL23). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 GWAS of Suicide Attempt in Psychiatric Disorders and Association With Major Depression Polygenic Risk Scores.Am J Psychiatry. 2019 Aug 1;176(8):651-660. doi: 10.1176/appi.ajp.2019.18080957. Epub 2019 Jun 5.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
9 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
15 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.