General Information of Drug Off-Target (DOT) (ID: OT2VQWK3)

DOT Name Exonuclease mut-7 homolog (EXD3)
Synonyms EC 3.1.-.-; Exonuclease 3'-5' domain-containing protein 3
Gene Name EXD3
Related Disease
Werner syndrome ( )
UniProt ID
MUT7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.1.-.-
Pfam ID
PF01612 ; PF01927
Sequence
MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFAALDDPLAGLL
DMLESCRGQRGEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARAVKVLTESPPS
LAAPLASIFQLQDADRSCLLAHVHRLHHEGRFREAATLGATLKLQSELGVEKMSIPLLLQ
DKVALVERYVAGFPDLQRRLLVLMDSWCQPGFDIKDVARRYPEVTSLSLEKLSPKALSRQ
VLRLQERYGVAPALCPNAAIQQRLAALRHLCHKRFVEKSLSQENWTDHVQGLVGQSPWLQ
EQLSQLLVSHSDPVTAAQCAMELLLPEERLPAAVAVELRRFRLQGRATEADSRLEVKDMK
DRYYQLPIPRENVHLLASWEDLTRHEGALLQCHQVVGVDVEWTPVFVAGGRPRPSLLQVA
VEGHVFLLDVLALSQPPTGQGAQAFSRLVAQLLSDPSITKLGYGMVGDLQKLGTSCPALA
HVEKQILGGMDLLLVHRQMRVASVPAPAVDRARELRGLSLLVQQVLGTALDKTQQLSNWD
RRPLCEEQVIYAAADAYCLLEVHQALCREPARFHLSEDLAGSRRPRHRERPGARKPPGLQ
KASAPAAPRQVPVAVAVSEGAAPQIPARAFRVVCDNMLQGLARSLRCLGVDARMLGNGED
HRRAAEVARQEGRIILTSGQPFHKLRAQVGAGRCLSVDCSLKAQQQAKAVLKHFNVRVTH
ADIFSRCQACNCDQYLKVSRDMMKQLMWLSSHQEGPRSSGDEATQSQAVQEPGPAPDAAP
EGCTYDRPCRWLQMADLRAETPDMLADGTRLQLAGVPVGVLRTPGLRCFYCCTGCGKVFW
DGSHLGRVATHFRDMLESAPSPCEPSPAPSPASSPF
Function Possesses 3'-5' exoribonuclease activity. Required for 3'-end trimming of AGO1-bound miRNAs.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Werner syndrome DISZY45W moderate Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Exonuclease mut-7 homolog (EXD3). [2]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Exonuclease mut-7 homolog (EXD3). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Exonuclease mut-7 homolog (EXD3). [7]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Exonuclease mut-7 homolog (EXD3). [3]
Estradiol DMUNTE3 Approved Estradiol affects the expression of Exonuclease mut-7 homolog (EXD3). [4]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Exonuclease mut-7 homolog (EXD3). [6]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Exonuclease mut-7 homolog (EXD3). [8]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Exonuclease mut-7 homolog (EXD3). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Exonuclease mut-7 homolog (EXD3). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Exonuclease mut-7 homolog (EXD3). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Mut-7 of C. elegans, required for transposon silencing and RNA interference, is a homolog of Werner syndrome helicase and RNaseD.Cell. 1999 Oct 15;99(2):133-41. doi: 10.1016/s0092-8674(00)81645-1.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
5 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
6 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
9 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
10 Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
11 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.