General Information of Drug Off-Target (DOT) (ID: OT37KCUL)

DOT Name Tetratricopeptide repeat protein 29 (TTC29)
Synonyms TPR repeat protein 29; Protein TBPP2A; Testis development protein NYD-SP14
Gene Name TTC29
Related Disease
Male infertility ( )
Spermatogenic failure 42 ( )
Obsolete non-syndromic male infertility due to sperm motility disorder ( )
UniProt ID
TTC29_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8J07
Pfam ID
PF13424 ; PF13432
Sequence
MTTLPPLPMTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAY
RNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYL
YHYLTRAEDAERKESFEDVHNNLYALACYFNNSEDKWVRNHFYERCFKIAQLIKIDCGKK
EAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLL
SDKMLENKEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTY
CKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQSLDLVRASTML
GDIYNEKGYYNKASECFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESAD
LTSLNYLLSWKESRGNIEPDPVTEEFRGSTVEAVSQNSERLEELSRFPGDQKNET
Function Axonemal protein which is implicated in axonemal and/or peri-axonemal structures assembly and regulates flagella assembly and beating and therefore sperm motility.
Tissue Specificity Expressed in spermatozoa (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Male infertility DISY3YZZ Strong Genetic Variation [1]
Spermatogenic failure 42 DISLH7U4 Strong Autosomal recessive [1]
Obsolete non-syndromic male infertility due to sperm motility disorder DISG7641 Supportive Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Tetratricopeptide repeat protein 29 (TTC29). [2]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Tetratricopeptide repeat protein 29 (TTC29). [3]
Triclosan DMZUR4N Approved Triclosan increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [4]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Tetratricopeptide repeat protein 29 (TTC29). [5]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [6]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [7]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [8]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Tetratricopeptide repeat protein 29 (TTC29). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Mutations in TTC29, Encoding an Evolutionarily Conserved Axonemal Protein, Result in Asthenozoospermia and Male Infertility. Am J Hum Genet. 2019 Dec 5;105(6):1148-1167. doi: 10.1016/j.ajhg.2019.10.007. Epub 2019 Nov 14.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
6 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
7 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
8 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
9 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
10 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.