Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT43PD2V)

• DOT Name: Insulin gene enhancer protein ISL-2 (ISL2)
• Synonyms: Islet-2
• Gene Name: ISL2
• UniProt ID: ISL2_HUMAN
• Pfam ID: PF00046 ; PF00412
• Sequence:
  MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
  YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
  SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPAL
  RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
  NKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP
  WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
• Function: Transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[5]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[5]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[7]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[5]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Insulin gene enhancer protein ISL-2 (ISL2).	[8]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.