| DOT Name |
Interferon alpha-2 (IFNA2)
|
| Synonyms |
IFN-alpha-2; Interferon alpha-A; LeIF A |
| Gene Name |
IFNA2
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1ITF ; 1RH2 ; 2HYM ; 2KZ1 ; 2LAG ; 2LMS ; 3S9D ; 3SE3 ; 4YPG ; 4Z5R
|
| Pfam ID |
|
| Sequence |
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL QESLRSKE
|
| Function |
Produced by macrophages, IFN-alpha have antiviral activities. |
| KEGG Pathway |
- Cytokine-cytokine receptor interaction (hsa04060 )
- PI3K-Akt sig.ling pathway (hsa04151 )
- Necroptosis (hsa04217 )
- Toll-like receptor sig.ling pathway (hsa04620 )
- NOD-like receptor sig.ling pathway (hsa04621 )
- RIG-I-like receptor sig.ling pathway (hsa04622 )
- Cytosolic D.-sensing pathway (hsa04623 )
- JAK-STAT sig.ling pathway (hsa04630 )
- .tural killer cell mediated cytotoxicity (hsa04650 )
- Alcoholic liver disease (hsa04936 )
- Tuberculosis (hsa05152 )
- Hepatitis C (hsa05160 )
- Hepatitis B (hsa05161 )
- Measles (hsa05162 )
- Human cytomegalovirus infection (hsa05163 )
- Influenza A (hsa05164 )
- Human papillomavirus infection (hsa05165 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Herpes simplex virus 1 infection (hsa05168 )
- Epstein-Barr virus infection (hsa05169 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Coro.virus disease - COVID-19 (hsa05171 )
- Pathways in cancer (hsa05200 )
- Autoimmune thyroid disease (hsa05320 )
- Lipid and atherosclerosis (hsa05417 )
|
| Reactome Pathway |
- Regulation of IFNA/IFNB signaling (R-HSA-912694 )
- TRAF6 mediated IRF7 activation (R-HSA-933541 )
- SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
- Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
- Interferon alpha/beta signaling (R-HSA-909733 )
|
|
|
|
|
|
|