Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT52GZR2)

DOT Name Renin (REN)
Synonyms EC 3.4.23.15; Angiotensinogenase
Gene Name REN
Related Disease
Familial juvenile hyperuricemic nephropathy type 2 ( )
Renal tubular dysgenesis of genetic origin ( )
UniProt ID
RENI_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1BBS ; 1BIL ; 1BIM ; 1HRN ; 1RNE ; 2BKS ; 2BKT ; 2FS4 ; 2G1N ; 2G1O ; 2G1R ; 2G1S ; 2G1Y ; 2G20 ; 2G21 ; 2G22 ; 2G24 ; 2G26 ; 2G27 ; 2I4Q ; 2IKO ; 2IKU ; 2IL2 ; 2REN ; 2V0Z ; 2V10 ; 2V11 ; 2V12 ; 2V13 ; 2V16 ; 2X0B ; 3D91 ; 3G6Z ; 3G70 ; 3G72 ; 3GW5 ; 3K1W ; 3KM4 ; 3O9L ; 3OAD ; 3OAG ; 3OOT ; 3OQF ; 3OQK ; 3OWN ; 3Q3T ; 3Q4B ; 3Q5H ; 3SFC ; 3VCM ; 3VSW ; 3VSX ; 3VUC ; 3VYD ; 3VYE ; 3VYF ; 4AMT ; 4GJ5 ; 4GJ6 ; 4GJ7 ; 4GJ8 ; 4GJ9 ; 4GJA ; 4GJB ; 4GJC ; 4GJD ; 4PYV ; 4Q1N ; 4RYC ; 4RYG ; 4RZ1 ; 4S1G ; 4XX3 ; 4XX4 ; 5KOQ ; 5KOS ; 5KOT ; 5SXN ; 5SY2 ; 5SY3 ; 5SZ9 ; 5T4S ; 5TMG ; 5TMK ; 5V8V ; 5VPM ; 5VRP ; 6I3F ; 7XGK ; 7XGO ; 7XGP
EC Number
3.4.23.15
Pfam ID
PF07966 ; PF00026
Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
KEGG Pathway
Renin-angiotensin system (hsa04614 )
Renin secretion (hsa04924 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Familial juvenile hyperuricemic nephropathy type 2 DISUJD9Q Definitive Autosomal dominant [1]
Renal tubular dysgenesis of genetic origin DISIP4Y5 Definitive Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Spironolactone DM2AQ5N Approved Renin (REN) decreases the response to substance of Spironolactone. [66]
Theophylline DMRJFN9 Approved Renin (REN) increases the Hypotension ADR of Theophylline. [67]
NEUROTENSIN DM27WCE Investigative Renin (REN) increases the Vascular hypotensive disorders ADR of NEUROTENSIN. [67]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Renin (REN). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Renin (REN). [55]
------------------------------------------------------------------------------------
70 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the activity of Renin (REN). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the activity of Renin (REN). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Renin (REN). [5]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the activity of Renin (REN). [6]
Dexamethasone DMMWZET Approved Dexamethasone increases the activity of Renin (REN). [7]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the activity of Renin (REN). [8]
Aspirin DM672AH Approved Aspirin decreases the activity of Renin (REN). [9]
Indomethacin DMSC4A7 Approved Indomethacin decreases the activity of Renin (REN). [10]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the activity of Renin (REN). [11]
Sulindac DM2QHZU Approved Sulindac decreases the activity of Renin (REN). [12]
Hydrocortisone DMGEMB7 Approved Hydrocortisone decreases the expression of Renin (REN). [13]
Isoproterenol DMK7MEY Approved Isoproterenol increases the activity of Renin (REN). [14]
Nifedipine DMSVOZT Approved Nifedipine increases the activity of Renin (REN). [15]
Propranolol DM79NTF Approved Propranolol decreases the activity of Renin (REN). [16]
Phenylephrine DMZHUO5 Approved Phenylephrine decreases the activity of Renin (REN). [17]
Epinephrine DM3KJBC Approved Epinephrine increases the activity of Renin (REN). [14]
Carvedilol DMHTEAO Approved Carvedilol decreases the expression of Renin (REN). [18]
Naproxen DMZ5RGV Approved Naproxen decreases the activity of Renin (REN). [12]
Ketamine DMT5HA4 Approved Ketamine increases the expression of Renin (REN). [19]
Atenolol DMNKG1Z Approved Atenolol decreases the activity of Renin (REN). [20]
Clonidine DM6RZ9Q Approved Clonidine decreases the activity of Renin (REN). [21]
Salbutamol DMN9CWF Approved Salbutamol increases the expression of Renin (REN). [22]
Dobutamine DMD1B8Z Approved Dobutamine increases the expression of Renin (REN). [23]
Furosemide DMMQ8ZG Approved Furosemide increases the activity of Renin (REN). [24]
Metoprolol DMOJ0V6 Approved Metoprolol decreases the expression of Renin (REN). [18]
Hydralazine DMU8JGH Approved Hydralazine increases the activity of Renin (REN). [25]
Phentolamine DMXYJOB Approved Phentolamine increases the activity of Renin (REN). [26]
Terbutaline DMD4381 Approved Terbutaline increases the expression of Renin (REN). [23]
Benazepril DMH1M9B Approved Benazepril increases the expression of Renin (REN). [27]
Enalapril DMNFUZR Approved Enalapril decreases the activity of Renin (REN). [28]
Perindopril DMOPZDT Approved Perindopril increases the activity of Renin (REN). [29]
Hydrochlorothiazide DMUSZHD Approved Hydrochlorothiazide increases the activity of Renin (REN). [30]
Cenestin DMXQS7K Approved Cenestin increases the activity of Renin (REN). [8]
Ranitidine DM0GUSX Approved Ranitidine affects the activity of Renin (REN). [31]
Isradipine DMA5XGH Approved Isradipine increases the activity of Renin (REN). [32]
Candesartan DMRK8OT Approved Candesartan decreases the activity of Renin (REN). [28]
Naloxone DM3FXMA Approved Naloxone increases the activity of Renin (REN). [33]
Labetalol DMK8U72 Approved Labetalol decreases the activity of Renin (REN). [34]
Rhucin DM3ADGP Approved Rhucin increases the activity of Renin (REN). [35]
Alprostadil DMWH7NQ Approved Alprostadil increases the expression of Renin (REN). [36]
Ramipril DM2R68E Approved Ramipril increases the activity of Renin (REN). [37]
Minoxidil DMA2Z4F Approved Minoxidil affects the expression of Renin (REN). [38]
Bumetanide DMRV7H0 Approved Bumetanide increases the expression of Renin (REN). [39]
Nitrendipine DM21C09 Approved Nitrendipine increases the activity of Renin (REN). [40]
Fenoterol DMIP3ZV Approved Fenoterol increases the activity of Renin (REN). [41]
Indapamide DMGN1PW Approved Indapamide increases the expression of Renin (REN). [42]
Magnesium Sulfate DMVEK07 Approved Magnesium Sulfate increases the activity of Renin (REN). [43]
Isoflurane DMY6T31 Approved Isoflurane affects the activity of Renin (REN). [44]
Acebutolol DM0TI4U Approved Acebutolol decreases the activity of Renin (REN). [45]
Trandolapril DM4L6EU Approved Trandolapril increases the expression of Renin (REN). [39]
Bendroflumethiazide DM7EVLC Approved Bendroflumethiazide increases the expression of Renin (REN). [46]
Reboxetine DM26PRD Approved Reboxetine decreases the activity of Renin (REN). [47]
Oxprenolol DM51OQW Approved Oxprenolol decreases the activity of Renin (REN). [26]
Pindolol DMD2NV7 Approved Pindolol decreases the activity of Renin (REN). [48]
Connexyn DMF29Q5 Approved Connexyn decreases the activity of Renin (REN). [49]
Dihydralazine DMZIXU9 Approved Dihydralazine increases the activity of Renin (REN). [50]
Chlorthalidone DM4DMBT Approved Chlorthalidone increases the activity of Renin (REN). [51]
Glyceryl trinitrate DMF72W3 Phase 4 Glyceryl trinitrate increases the activity of Renin (REN). [52]
Glycyrrhizin DM8M2N3 Phase 3 Glycyrrhizin decreases the activity of Renin (REN). [53]
AMG 386 DMQJXL4 Phase 3 AMG 386 increases the activity of Renin (REN). [54]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the activity of Renin (REN). [56]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 affects the expression of Renin (REN). [57]
Ticrynafen DMLFSTR Withdrawn from market Ticrynafen increases the activity of Renin (REN). [58]
Alprenolol DMYJ8Z3 Withdrawn from market Alprenolol decreases the expression of Renin (REN). [59]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Renin (REN). [62]
Forskolin DM6ITNG Investigative Forskolin increases the expression of Renin (REN). [60]
Erythropoietin DM3R8YL Investigative Erythropoietin increases the activity of Renin (REN). [63]
Irbesartan DMTP1DC Investigative Irbesartan increases the expression of Renin (REN). [64]
Lisinopril DMUOK4C Investigative Lisinopril increases the expression of Renin (REN). [65]
18beta-Glycyrrhetic acid DMFMRN8 Investigative 18beta-Glycyrrhetic acid decreases the activity of Renin (REN). [53]
------------------------------------------------------------------------------------
⏷ Show the Full List of 70 Drug(s)
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ro 20-1724 DM0PSCF Terminated Ro 20-1724 increases the secretion of Renin (REN). [60]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the binding of Renin (REN). [61]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Suppression of plasma renin activity by cyclosporine. Am J Med. 1987 Jul;83(1):59-64. doi: 10.1016/0002-9343(87)90497-9.
4 Human atrial natriuretic factor and renin-aldosterone in paracetamol induced fulminant hepatic failure. Gut. 1991 Jan;32(1):85-9. doi: 10.1136/gut.32.1.85.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Effectiveness of 1,25-dihydroxyvitamin D supplementation on blood pressure reduction in a pseudohypoparathyroidism patient with high renin activity. Intern Med. 1999 Jan;38(1):31-5. doi: 10.2169/internalmedicine.38.31.
7 Male pseudohermaphroditism with hypertension due to a 17alpha-hydroxylation deficiency. Clin Endocrinol (Oxf). 1976 Jan;5(1):53-61.
8 Estrogens and hypertension: effect of discontinuing estrogens on blood pressure, exchangeable sodium, and the renin-aldosterone system. Am J Med Sci. 1978 Jul-Aug;276(1):33-55.
9 Time-dependent effects of low-dose aspirin on plasma renin activity, aldosterone, cortisol, and catecholamines. Hypertension. 2009 Nov;54(5):1136-42. doi: 10.1161/HYPERTENSIONAHA.109.134825. Epub 2009 Oct 5.
10 Acute renal effects of sulindac and indomethacin in chronic renal failure. Clin Pharmacol Ther. 1985 Apr;37(4):447-52. doi: 10.1038/clpt.1985.69.
11 Influence of the M235T polymorphism of human angiotensinogen (AGT) on plasma AGT and renin concentrations after ethinylestradiol administration. J Clin Endocrinol Metab. 2000 Nov;85(11):4331-7. doi: 10.1210/jcem.85.11.6932.
12 Effects of sulindac and naproxen on prostaglandin excretion in patients with impaired renal function and rheumatoid arthritis. Am J Med. 1990 Sep;89(3):313-21. doi: 10.1016/0002-9343(90)90344-d.
13 Acute effects of hydrocortisone on plasma nitrate/nitrite activity and forearm vasodilator responsiveness in normal human subjects. Clin Exp Pharmacol Physiol. 2005 Mar;32(3):162-6. doi: 10.1111/j.1440-1681.2005.04173.x.
14 Hypokalemia from beta2-receptor stimulation by circulating epinephrine. N Engl J Med. 1983 Dec 8;309(23):1414-9. doi: 10.1056/NEJM198312083092303.
15 Captopril and nifedipine interactions in the treatment of essential hypertensives: a crossover study. J Hypertens Suppl. 1987 Dec;5(4):S139-42. doi: 10.1097/00004872-198712004-00023.
16 Intrapatient comparison of treatment with chlorthalidone, spironolactone and propranolol in normoreninemic essential hypertension. Am J Cardiol. 1975 Oct 31;36(5):716-21. doi: 10.1016/0002-9149(75)90174-5.
17 [Effects of phenylephrine on atrial natriuretic factor and the renin-aldosterone axis in normal patients and essential hypertensive patients]. Arch Mal Coeur Vaiss. 1988 Jun;81 Spec No:75-8.
18 Effect of carvedilol and metoprolol on blood pressure, blood flow, and vascular resistance. J Cardiovasc Pharmacol. 1987;10 Suppl 11:S124-9.
19 Ketamine hypertension and the renin-angiotensin system. Clin Exp Hypertens A. 1983;5(6):875-83. doi: 10.3109/10641968309081814.
20 Effects of the direct renin inhibitor aliskiren and atenolol alone or in combination in patients with hypertension. J Renin Angiotensin Aldosterone Syst. 2008 Sep;9(3):163-75. doi: 10.1177/1470320308096411.
21 The effect of clonidine and penbutolol, respectively on catecholamines in blood and urine, plasma renin activity and urinary aldosterone in hypertensive patients. Arch Int Pharmacodyn Ther. 1975 Feb;213(2):307-21.
22 Hypokalaemia and other non-bronchial effects of inhaled fenoterol and salbutamol: a placebo-controlled dose-response study in healthy volunteers. Br J Clin Pharmacol. 1987 Nov;24(5):645-53. doi: 10.1111/j.1365-2125.1987.tb03224.x.
23 Beta-adrenoceptor activation-induced placental prorenin secretion is mediated by increased renin messenger RNA and protein synthesis. Mol Pharmacol. 1997 Feb;51(2):201-8. doi: 10.1124/mol.51.2.201.
24 Endogenous bradykinin and the renin and pressor responses to furosemide in humans. J Pharmacol Exp Ther. 2000 Nov;295(2):644-8.
25 Sympathetic activity in idiopathic dilated cardiomyopathy. Influence of captopril and hydralazine. Cardiovasc Drugs Ther. 1987 Aug;1(2):177-81. doi: 10.1007/BF02125471.
26 Mediation of renin release in essential hypertension by alpha-adrenoreceptors. J Cardiovasc Pharmacol. 1981 Nov-Dec;3(6):1153-61. doi: 10.1097/00005344-198111000-00001.
27 Sympathomoderating influence of benazepril in essential hypertension. J Hypertens. 1992 Apr;10(4):373-8. doi: 10.1097/00004872-199204000-00009.
28 A nonpeptide, piperidine renin inhibitor provides renal and cardiac protection in double-transgenic mice expressing human renin and angiotensinogen genes. Cardiovasc Drugs Ther. 2008 Dec;22(6):469-78. doi: 10.1007/s10557-008-6131-x. Epub 2008 Aug 5.
29 Experience with perindopril in normal volunteers. Arch Mal Coeur Vaiss. 1989 May;82 Spec No 1:35-41.
30 Long-term effect of nifedipine and hydrochlorothiazide on blood pressure and sodium homeostasis at varying levels of salt intake in mildly hypertensive patients. Am J Hypertens. 1991 Sep;4(9):752-60. doi: 10.1093/ajh/4.9.752.
31 Effects of histamine H2-receptor blockade on the cardiovascular reflex response to lower-body negative pressure in man. Acta Physiol Scand. 1990 May;139(1):161-72. doi: 10.1111/j.1748-1716.1990.tb08909.x.
32 Acute calcium entry blockade inhibits the blood pressure but not the hormonal responses to angiotensin II. Eur J Clin Pharmacol. 1989;36(6):567-73. doi: 10.1007/BF00637737.
33 beta-Endorphin and essential hypertension: importance of the clonidine-naloxone interaction. Acta Physiol Hung. 1985;65(2):217-26.
34 Hemodynamic and humoral effects of intravenous dilevalol in patients with moderate hypertension. Am J Cardiol. 1989 Jun 5;63(19):34I-37I. doi: 10.1016/0002-9149(89)90126-4.
35 Inhibition of cGMP-specific phosphodiesterase type 5 reduces sodium excretion and arterial blood pressure in patients with NaCl retention and ascites. Am J Physiol Renal Physiol. 2005 May;288(5):F1044-52. doi: 10.1152/ajprenal.00142.2004. Epub 2004 Dec 21.
36 Catecholamine and renin-angiotensin response during controlled hypotension induced by prostaglandin E1 combined with hemodilution during isoflurane anesthesia. J Clin Anesth. 1997 Jun;9(4):321-7. doi: 10.1016/s0952-8180(97)00011-1.
37 Effects of an angiotensin converting enzyme inhibitor, ramipril, on intracranial circulation in healthy volunteers. off. Br J Clin Pharmacol. 1992 Sep;34(3):224-30. doi: 10.1111/j.1365-2125.1992.tb04128.x.
38 Need for beta-blockade in hypertension reduced with long-term minoxidil. Br Med J. 1978 Aug 5;2(6134):385-8. doi: 10.1136/bmj.2.6134.385.
39 Dosage dependent hormonal counter regulation to combination therapy in patients with left ventricular dysfunction. J Clin Pharm Ther. 2006 Apr;31(2):139-47. doi: 10.1111/j.1365-2710.2006.00606.x.
40 Relative potency of a beta-blocking and a calcium entry blocking agent as antihypertensive drugs in black patients. Eur J Clin Pharmacol. 1986;29(5):523-7. doi: 10.1007/BF00635887.
41 Fenoterol but not dobutamine increases erythropoietin production in humans. Clin Pharmacol Ther. 1997 Jun;61(6):669-76. doi: 10.1016/S0009-9236(97)90102-8.
42 Antihypertensive effect of indapamide with special emphasis on renal prostaglandin production. Curr Med Res Opin. 1983;8 Suppl 3:81-6. doi: 10.1185/03007998309109841.
43 Haemodynamic and endocrine effects of deliberate hypotension with magnesium sulphate for cerebral-aneurysm surgery. Eur J Anaesthesiol. 1991 Mar;8(2):115-21.
44 The stress response to induced hypotension for cerebral aneurysm surgery: a comparison of two hypotensive techniques. Can J Anaesth. 1988 Mar;35(2):111-5. doi: 10.1007/BF03010648.
45 Addition of acebutolol to diuretics in hypertension. Clin Pharmacol Ther. 1981 Dec;30(6):739-44. doi: 10.1038/clpt.1981.232.
46 Low renin hypertension. A distinct entity. Lancet. 1976 Oct 30;2(7992):930-2. doi: 10.1016/s0140-6736(76)90892-8.
47 Influences of norepinephrine transporter function on the distribution of sympathetic activity in humans. Hypertension. 2006 Jul;48(1):120-6. doi: 10.1161/01.HYP.0000225424.13138.5d. Epub 2006 May 22.
48 Beta-adrenergic receptor blocking drugs, hypertension and plasma renin. Br J Clin Pharmacol. 1975 Apr;2(2):159-64. doi: 10.1111/j.1365-2125.1975.tb01571.x.
49 [Effect of 5-month guanfacine treatment on the renin-angiotensin-aldosterone system and some metabolic factors in patients with diabetes mellitus type II and hypertension]. Pol Tyg Lek. 1992 Nov 16-30;47(46-48):1045-7.
50 Additive effects of dihydralazine during enflurane or isoflurane hypotensive anaesthesia for spinal fusion. Can J Anaesth. 1988 May;35(3 ( Pt 1)):242-8. doi: 10.1007/BF03010617.
51 Detection of low-renin hypertension; evaluation of out-patient renin-stimulating methods. Clin Sci Mol Med. 1975 Feb;48(2):91-6. doi: 10.1042/cs0480091.
52 Comparison of atrial natriuretic peptide versus nitroglycerin for reducing blood pressure in acute myocardial infarction. Am J Cardiol. 1998 Mar 15;81(6):781-4. doi: 10.1016/s0002-9149(97)01033-3.
53 Inhibition of human renin activity by saponins. Biomed Res. 2010 Apr;31(2):155-9. doi: 10.2220/biomedres.31.155.
54 Endothelial function during stimulation of renin-angiotensin system by low-sodium diet in humans. Am J Physiol Heart Circ Physiol. 2001 May;280(5):H2248-54. doi: 10.1152/ajpheart.2001.280.5.H2248.
55 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
56 Caffeine attenuates the renal vascular response to angiotensin II infusion. Hypertension. 1993 Dec;22(6):847-52. doi: 10.1161/01.hyp.22.6.847.
57 The role of adenosine in promoting cardiac beta-adrenergic subsensitivity in aging humans. J Gerontol A Biol Sci Med Sci. 1995 May;50(3):B128-34. doi: 10.1093/gerona/50a.3.b128.
58 Effects of prostaglandins inhibition on changes in active and inactive renin induced by antihypertensive drugs. Clin Exp Hypertens A. 1982;4(11-12):2435-48. doi: 10.3109/10641968209062401.
59 Plasma renin concentration in essential hypertension during beta-adrenergic blockade and vasodilator therapy. Eur J Clin Pharmacol. 1977 Oct 14;12(2):93-6. doi: 10.1007/BF00645128.
60 Beta-adrenergic regulation of renin expression in differentiated U-937 monocytic cells. Biochem Pharmacol. 1997 Jun 15;53(12):1883-8. doi: 10.1016/s0006-2952(97)00058-0.
61 Systems toxicology approach explores target-pathway relationship and adverse health impacts of ubiquitous environmental pollutant bisphenol A. J Toxicol Environ Health A. 2022 Mar 19;85(6):217-229. doi: 10.1080/15287394.2021.1994492. Epub 2021 Oct 27.
62 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
63 Hemodynamic and neurohumoral effects of the angiotensin II antagonist losartan in patients with heart failure. J Hypertens Suppl. 1994 Jul;12(2):S31-5.
64 Long-term effects of irbesartan and atenolol on the renin-angiotensin-aldosterone system in human primary hypertension: the Swedish Irbesartan Left Ventricular Hypertrophy Investigation versus Atenolol (SILVHIA). J Cardiovasc Pharmacol. 2003 Dec;42(6):719-26. doi: 10.1097/00005344-200312000-00005.
65 Hemodynamic responses to converting enzyme inhibition in patients with renal disease. Am J Hypertens. 1989 Aug;2(8):599-603. doi: 10.1093/ajh/2.8.599.
66 Clinical and biochemical effects of spironolactone administered once daily in primary hypertension. Multicenter Sweden study. Hypertension. 1980 Sep-Oct;2(5):672-9. doi: 10.1161/01.hyp.2.5.672.
67 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.