Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5ITHAW)

DOT Name Plasminogen receptor (PLGRKT)
Synonyms KT; Plg-R(KT)
Gene Name PLGRKT
Related Disease
Alcohol dependence ( )
Alcohol-induced disorders ( )
Alcohol-related disorders ( )
UniProt ID
PLRKT_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF10166
Sequence
MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTF
FGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSK
LQLPRGMITFESIEKARKEQSRFFIDK
Function
Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metalloproteinase activation, such as of MMP2 and MMP9.
Tissue Specificity Expressed in peripheral blood cells and monocytes. Expressed in adrenal medulla.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alcohol dependence DIS4ZSCO moderate Genetic Variation [1]
Alcohol-induced disorders DIS3SFYT moderate Genetic Variation [1]
Alcohol-related disorders DIS3K4KK moderate Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Plasminogen receptor (PLGRKT). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Plasminogen receptor (PLGRKT). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Plasminogen receptor (PLGRKT). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Plasminogen receptor (PLGRKT). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Plasminogen receptor (PLGRKT). [6]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Plasminogen receptor (PLGRKT). [7]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Plasminogen receptor (PLGRKT). [8]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of Plasminogen receptor (PLGRKT). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Plasminogen receptor (PLGRKT). [10]
QUERCITRIN DM1DH96 Investigative QUERCITRIN decreases the expression of Plasminogen receptor (PLGRKT). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Plasminogen receptor (PLGRKT). [11]
------------------------------------------------------------------------------------

References

1 Ancestry-specific and sex-specific risk alleles identified in a genome-wide gene-by-alcohol dependence interaction study of risky sexual behaviors.Am J Med Genet B Neuropsychiatr Genet. 2017 Dec;174(8):846-853. doi: 10.1002/ajmg.b.32604. Epub 2017 Oct 9.
2 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
9 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.