Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5QWTD2)

DOT Name Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2)
Synonyms EC 2.3.2.27; RING-type E3 ubiquitin transferase TRIML2; SPRY domain-containing protein 6; Tripartite motif family-like protein 2
Gene Name TRIML2
Related Disease
Advanced cancer ( )
Alzheimer disease ( )
Triple negative breast cancer ( )
Choriocarcinoma ( )
Herpes simplex infection ( )
UniProt ID
TRIMM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.27
Pfam ID
PF13765 ; PF00622 ; PF00643
Sequence
MSKRLSPQLQHNITEDAYCETHLEPTRLFCDVDQITLCSKCFQSQEHKHHMVCGIQEAAE
NYRKLFQEILNTSREKLEAAKSILTDEQERMAMIQEEEQNFKKMIESEYSMRLRLLNEEC
EQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLKESEARA
SEQVRSLLKLIVELEKKCGEGTLALLKNAKYSLERSKSLLLEHLEPAHITDLSLCHIRGL
SSMFRVLQRHLTLDPETAHPCLALSEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFT
SGRHYWEVDVEKATRWQVGIYHGSADAKGSTARASGEKVLLTGSVMGTEWTLWVFPPLKR
LFLEKKLDTVGVFLDCEHGQISFYNVTEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPD
SLTILQHGPSCDATVSP

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Alzheimer disease DISF8S70 Strong Biomarker [1]
Triple negative breast cancer DISAMG6N Strong Altered Expression [2]
Choriocarcinoma DISDBVNL moderate Biomarker [3]
Herpes simplex infection DISL1SAV Disputed Altered Expression [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2). [5]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2). [6]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2). [7]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2). [9]
------------------------------------------------------------------------------------

References

1 Increased expression of tripartite motif (TRIM) like 2 promotes tumoral growth in human oral cancer.Biochem Biophys Res Commun. 2019 Jan 22;508(4):1133-1138. doi: 10.1016/j.bbrc.2018.12.060. Epub 2018 Dec 13.
2 Characterization of ceRNA network to reveal potential prognostic biomarkers in triple-negative breast cancer.PeerJ. 2019 Sep 9;7:e7522. doi: 10.7717/peerj.7522. eCollection 2019.
3 Eutherian-Specific Gene TRIML2 Attenuates Inflammation in the Evolution of Placentation.Mol Biol Evol. 2020 Feb 1;37(2):507-523. doi: 10.1093/molbev/msz238.
4 STAT6 degradation and ubiquitylated TRIML2 are essential for activation of human oncogenic herpesvirus.PLoS Pathog. 2018 Dec 10;14(12):e1007416. doi: 10.1371/journal.ppat.1007416. eCollection 2018 Dec.
5 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
6 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
7 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
8 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.