Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5UYZL7)

DOT Name	Dimethylaniline monooxygenase 4 (FMO4)
Synonyms	EC 1.14.13.8; Dimethylaniline oxidase 4; Hepatic flavin-containing monooxygenase 4; FMO 4
Gene Name	FMO4
UniProt ID	FMO4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	1.14.13.8
Pfam ID	PF00743
Sequence	MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVT NVCKEMSCYSDFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFS ETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE GFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCC SFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT SVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKQVFPLNL ERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWD GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASLLLICKSSLFLKLV RDKLQDRMSPYLVSLWRG
Function	This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.
Tissue Specificity	Liver.
KEGG Pathway	Taurine and hypotaurine metabolism (hsa00430 ) Drug metabolism - cytochrome P450 (hsa00982 ) Metabolic pathways (hsa01100 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[7]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[7]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[8]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Dimethylaniline monooxygenase 4 (FMO4).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Drug(s)

References

1	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
2	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
8	Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
9	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
10	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
11	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.