General Information of Drug Off-Target (DOT) (ID: OT7IWAOI)

DOT Name Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A)
Gene Name COQ10A
UniProt ID
CQ10A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF03364
Sequence
MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQI
LAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKS
LVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGI
PAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELM
FHEVHQT
Function
Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes (Probable).
Reactome Pathway
Respiratory electron transport (R-HSA-611105 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [6]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [7]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [9]
KOJIC ACID DMP84CS Investigative KOJIC ACID increases the expression of Coenzyme Q-binding protein COQ10 homolog A, mitochondrial (COQ10A). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Effect of mitochondrial dysfunction and oxidative stress on endogenous levels of coenzyme Q(10) in human cells. J Biochem Mol Toxicol. 2011 Sep-Oct;25(5):280-9. doi: 10.1002/jbt.20387. Epub 2011 Feb 9.
8 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
9 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
10 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.